| Entry 1 |
| (1) Primary information |
|---|
| ID | 1265 |
| ThPP ID | Th1038 |
| Therapeutic Peptide/Protein Name | Omalizumab |
| Sequence | Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta |
| Functional Classification | IIa |
| Molecular Weight | 145058.2 |
| Chemical Formula | C6450H9916N1714O2023S38 |
| Isoelectric Point | 7.03 |
| Hydrophobicity | -0.432 |
| Melting Point (℃) | 61(FAB fra |
| Half Life | 624 hours |
| Description | A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin. |
| Indication/Disease | For treatment of asthma caused by allergies |
| Pharmacodynamics | Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma. |
| Mechanism of Action | Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | 78 ± 32 mL/kg |
| Clearance | Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile. |
| Categories | Anti-Allergic Agents |
| Patents Number | CA2113813 |
| Date of Issue | 12/04/05 |
| Date of Expiry | 14/08/12 |
| Drug Interaction | N.A. |
| Target | High affinity immunoglobulin epsilon receptor subunit alpha and beta |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Xolair |
| Company | Genentech Inc |
| Brand Discription | Xolair is a recombinant DNA-derived humanized IgG1_ monoclonal antibody that selectively binds to human immunoglobulin E (IgE). The antibody has a molecular weight of approximately 149 kiloDaltons. Xolair is produced by a Chinese hamster ovary cell suspen |
| Prescribed for | Xolair is used to treat moderate to severe asthma that is caused by allergies, and chronic idiopathic urticaria (a form of chronic hives) in adults and children who are at least 12 years old. Xolair is usually given after other asthma medications have bee |
| Chemical Name | N.A. |
| Formulation | Formulated in a single use vial that is reconstituted with sterile water for injection (SWFI), USP, and administered as a subcutaneous (SC) injection. Each 202.5 mg vial of omalizumab also contains L-histidine (1.8 mg), L-histidine hydrochloride monohydra |
| Physcial Appearance | Sterile, white, preservative free, lyophilized powder |
| Route of Administration | Subcutaneous Injection |
| Recommended Dosage | Xolair is administered at 150 to 375 mg by subcutaneous injection every 2 or 4 weeks. Determine doses (mg) and dosing frequency by serum total IgE level (IU/mL), measured before the start of treatment, and body weight (kg) as if serum IgE is less than 30-or >700 IU/mL and <66 or >330 lb, respectively) should not be dosed. |
| Contraindication | Severe hypersensitivity |
| Side Effects | Wheezing, tightness in your chest, trouble breathing; hives or skin rash; feeling anxious or light-headed, fainting; warmth or tingling under your skin; or swelling of your face, lips, tongue, or throat. |
| Useful Link | http://www.xolair.com |
| PubMed ID | 27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198 |
| 3-D Structure | Th1038 (View) or (Download) |
| Entry 2 |
| (2) Primary information |
|---|
| ID | 1266 |
| ThPP ID | Th1038 |
| Therapeutic Peptide/Protein Name | Omalizumab |
| Sequence | Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta |
| Functional Classification | IIa |
| Molecular Weight | 145058.2 |
| Chemical Formula | C6450H9916N1714O2023S38 |
| Isoelectric Point | 7.03 |
| Hydrophobicity | -0.432 |
| Melting Point (℃) | 61(FAB fra |
| Half Life | 624 hours |
| Description | A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin. |
| Indication/Disease | For treatment of asthma caused by allergies |
| Pharmacodynamics | Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma. |
| Mechanism of Action | Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | 78 ± 32 mL/kg |
| Clearance | Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile. |
| Categories | Anti-Asthmatic Agents |
| Patents Number | CA1340233 |
| Date of Issue | 15/12/98 |
| Date of Expiry | 15/12/15 |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Pain; headache, tired feeling; joint or muscle pain; dizziness; ear pain; hair loss; mild itching or skin rash; sore throat or cold symptoms; or redness, bruising, warmth, burning, stinging, itching, pain, or swelling of your skin where the injection was given. |
| Useful Link | http://www.drugs.com/xolair.html |
| PubMed ID | 27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198 |
| 3-D Structure | Th1038 (View) or (Download) |
| Entry 3 |
| (3) Primary information |
|---|
| ID | 1267 |
| ThPP ID | Th1038 |
| Therapeutic Peptide/Protein Name | Omalizumab |
| Sequence | Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta |
| Functional Classification | IIa |
| Molecular Weight | 145058.2 |
| Chemical Formula | C6450H9916N1714O2023S38 |
| Isoelectric Point | 7.03 |
| Hydrophobicity | -0.432 |
| Melting Point (℃) | 61(FAB fra |
| Half Life | 624 hours |
| Description | A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin. |
| Indication/Disease | For treatment of asthma caused by allergies |
| Pharmacodynamics | Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma. |
| Mechanism of Action | Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | 78 ± 32 mL/kg |
| Clearance | Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile. |
| Categories | Immunosuppressive Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.drugs.com/drug-interactions/omalizumab,xolair-index.html |
| PubMed ID | 27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198 |
| 3-D Structure | Th1038 (View) or (Download) |
| Entry 4 |
| (4) Primary information |
|---|
| ID | 1268 |
| ThPP ID | Th1038 |
| Therapeutic Peptide/Protein Name | Omalizumab |
| Sequence | Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta |
| Functional Classification | IIa |
| Molecular Weight | 145058.2 |
| Chemical Formula | C6450H9916N1714O2023S38 |
| Isoelectric Point | 7.03 |
| Hydrophobicity | -0.432 |
| Melting Point (℃) | 61(FAB fra |
| Half Life | 624 hours |
| Description | A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin. |
| Indication/Disease | For treatment of asthma caused by allergies |
| Pharmacodynamics | Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma. |
| Mechanism of Action | Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | 78 ± 32 mL/kg |
| Clearance | Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile. |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.rxlist.com/xolair-drug.htm |
| PubMed ID | 27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198 |
| 3-D Structure | Th1038 (View) or (Download) |