Detailed description page of THPdb

Details of Th1038 which contains 4 entries.

Entry 1
(1) Primary information
ID 1265
ThPP ID Th1038
Therapeutic Peptide/Protein Name Omalizumab
Sequence Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta
Functional Classification IIa
Molecular Weight 145058.2
Chemical Formula C6450H9916N1714O2023S38
Isoelectric Point 7.03
Hydrophobicity -0.432
Melting Point (℃) 61(FAB fra
Half Life 624 hours
Description A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin.
Indication/Disease For treatment of asthma caused by allergies
Pharmacodynamics Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma.
Mechanism of Action Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 78 Â± 32 mL/kg
Clearance Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile.
Categories Anti-Allergic Agents
Patents Number CA2113813
Date of Issue 12/04/05
Date of Expiry 14/08/12
Drug Interaction N.A.
Target High affinity immunoglobulin epsilon receptor subunit alpha and beta
Information of corresponding available drug in the market
Brand Name Xolair
Company Genentech Inc
Brand Discription Xolair is a recombinant DNA-derived humanized IgG1_ monoclonal antibody that selectively binds to human immunoglobulin E (IgE). The antibody has a molecular weight of approximately 149 kiloDaltons. Xolair is produced by a Chinese hamster ovary cell suspen
Prescribed for Xolair is used to treat moderate to severe asthma that is caused by allergies, and chronic idiopathic urticaria (a form of chronic hives) in adults and children who are at least 12 years old. Xolair is usually given after other asthma medications have bee
Chemical Name N.A.
Formulation Formulated in a single use vial that is reconstituted with sterile water for injection (SWFI), USP, and administered as a subcutaneous (SC) injection. Each 202.5 mg vial of omalizumab also contains L-histidine (1.8 mg), L-histidine hydrochloride monohydra
Physcial Appearance Sterile, white, preservative free, lyophilized powder
Route of Administration Subcutaneous Injection
Recommended Dosage Xolair is administered at 150 to 375 mg by subcutaneous injection every 2 or 4 weeks. Determine doses (mg) and dosing frequency by serum total IgE level (IU/mL), measured before the start of treatment, and body weight (kg) as if serum IgE is less than 30-or >700 IU/mL and <66 or >330 lb, respectively) should not be dosed.
Contraindication Severe hypersensitivity
Side Effects Wheezing, tightness in your chest, trouble breathing; hives or skin rash; feeling anxious or light-headed, fainting; warmth or tingling under your skin; or swelling of your face, lips, tongue, or throat.
Useful Link http://www.xolair.com
PubMed ID 27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198
3-D Structure Th1038 (View) or (Download)

Entry 2
(2) Primary information
ID 1266
ThPP ID Th1038
Therapeutic Peptide/Protein Name Omalizumab
Sequence Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta
Functional Classification IIa
Molecular Weight 145058.2
Chemical Formula C6450H9916N1714O2023S38
Isoelectric Point 7.03
Hydrophobicity -0.432
Melting Point (℃) 61(FAB fra
Half Life 624 hours
Description A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin.
Indication/Disease For treatment of asthma caused by allergies
Pharmacodynamics Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma.
Mechanism of Action Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 78 Â± 32 mL/kg
Clearance Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile.
Categories Anti-Asthmatic Agents
Patents Number CA1340233
Date of Issue 15/12/98
Date of Expiry 15/12/15
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Pain; headache, tired feeling; joint or muscle pain; dizziness; ear pain; hair loss; mild itching or skin rash; sore throat or cold symptoms; or redness, bruising, warmth, burning, stinging, itching, pain, or swelling of your skin where the injection was given.
Useful Link http://www.drugs.com/xolair.html
PubMed ID 27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198
3-D Structure Th1038 (View) or (Download)

Entry 3
(3) Primary information
ID 1267
ThPP ID Th1038
Therapeutic Peptide/Protein Name Omalizumab
Sequence Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta
Functional Classification IIa
Molecular Weight 145058.2
Chemical Formula C6450H9916N1714O2023S38
Isoelectric Point 7.03
Hydrophobicity -0.432
Melting Point (℃) 61(FAB fra
Half Life 624 hours
Description A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin.
Indication/Disease For treatment of asthma caused by allergies
Pharmacodynamics Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma.
Mechanism of Action Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 78 Â± 32 mL/kg
Clearance Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile.
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/drug-interactions/omalizumab,xolair-index.html
PubMed ID 27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198
3-D Structure Th1038 (View) or (Download)

Entry 4
(4) Primary information
ID 1268
ThPP ID Th1038
Therapeutic Peptide/Protein Name Omalizumab
Sequence Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta
Functional Classification IIa
Molecular Weight 145058.2
Chemical Formula C6450H9916N1714O2023S38
Isoelectric Point 7.03
Hydrophobicity -0.432
Melting Point (℃) 61(FAB fra
Half Life 624 hours
Description A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin.
Indication/Disease For treatment of asthma caused by allergies
Pharmacodynamics Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma.
Mechanism of Action Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution 78 Â± 32 mL/kg
Clearance Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/xolair-drug.htm
PubMed ID 27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198
3-D Structure Th1038 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1265
ThPP ID	Th1038
Therapeutic Peptide/Protein Name	Omalizumab
Sequence	Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	145058.2
Chemical Formula	C6450H9916N1714O2023S38
Isoelectric Point	7.03
Hydrophobicity	-0.432
Melting Point (℃)	61(FAB fra
Half Life	624 hours
Description	A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin.
Indication/Disease	For treatment of asthma caused by allergies
Pharmacodynamics	Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma.
Mechanism of Action	Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	78 Â± 32 mL/kg
Clearance	Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile.
Categories	Anti-Allergic Agents
Patents Number	CA2113813
Date of Issue	12/04/05
Date of Expiry	14/08/12
Drug Interaction	N.A.
Target	High affinity immunoglobulin epsilon receptor subunit alpha and beta
Information of corresponding available drug in the market
Brand Name	Xolair
Company	Genentech Inc
Brand Discription	Xolair is a recombinant DNA-derived humanized IgG1_ monoclonal antibody that selectively binds to human immunoglobulin E (IgE). The antibody has a molecular weight of approximately 149 kiloDaltons. Xolair is produced by a Chinese hamster ovary cell suspen
Prescribed for	Xolair is used to treat moderate to severe asthma that is caused by allergies, and chronic idiopathic urticaria (a form of chronic hives) in adults and children who are at least 12 years old. Xolair is usually given after other asthma medications have bee
Chemical Name	N.A.
Formulation	Formulated in a single use vial that is reconstituted with sterile water for injection (SWFI), USP, and administered as a subcutaneous (SC) injection. Each 202.5 mg vial of omalizumab also contains L-histidine (1.8 mg), L-histidine hydrochloride monohydra
Physcial Appearance	Sterile, white, preservative free, lyophilized powder
Route of Administration	Subcutaneous Injection
Recommended Dosage	Xolair is administered at 150 to 375 mg by subcutaneous injection every 2 or 4 weeks. Determine doses (mg) and dosing frequency by serum total IgE level (IU/mL), measured before the start of treatment, and body weight (kg) as if serum IgE is less than 30-or >700 IU/mL and <66 or >330 lb, respectively) should not be dosed.
Contraindication	Severe hypersensitivity
Side Effects	Wheezing, tightness in your chest, trouble breathing; hives or skin rash; feeling anxious or light-headed, fainting; warmth or tingling under your skin; or swelling of your face, lips, tongue, or throat.
Useful Link	http://www.xolair.com
PubMed ID	27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198
3-D Structure	Th1038 (View) or (Download)

(2) Primary information
Entry 2
ID	1266
ThPP ID	Th1038
Therapeutic Peptide/Protein Name	Omalizumab
Sequence	Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	145058.2
Chemical Formula	C6450H9916N1714O2023S38
Isoelectric Point	7.03
Hydrophobicity	-0.432
Melting Point (℃)	61(FAB fra
Half Life	624 hours
Description	A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin.
Indication/Disease	For treatment of asthma caused by allergies
Pharmacodynamics	Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma.
Mechanism of Action	Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	78 Â± 32 mL/kg
Clearance	Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile.
Categories	Anti-Asthmatic Agents
Patents Number	CA1340233
Date of Issue	15/12/98
Date of Expiry	15/12/15
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Pain; headache, tired feeling; joint or muscle pain; dizziness; ear pain; hair loss; mild itching or skin rash; sore throat or cold symptoms; or redness, bruising, warmth, burning, stinging, itching, pain, or swelling of your skin where the injection was given.
Useful Link	http://www.drugs.com/xolair.html
PubMed ID	27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198
3-D Structure	Th1038 (View) or (Download)

(3) Primary information
Entry 3
ID	1267
ThPP ID	Th1038
Therapeutic Peptide/Protein Name	Omalizumab
Sequence	Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	145058.2
Chemical Formula	C6450H9916N1714O2023S38
Isoelectric Point	7.03
Hydrophobicity	-0.432
Melting Point (℃)	61(FAB fra
Half Life	624 hours
Description	A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin.
Indication/Disease	For treatment of asthma caused by allergies
Pharmacodynamics	Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma.
Mechanism of Action	Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	78 Â± 32 mL/kg
Clearance	Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile.
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/drug-interactions/omalizumab,xolair-index.html
PubMed ID	27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198
3-D Structure	Th1038 (View) or (Download)

(4) Primary information
Entry 4
ID	1268
ThPP ID	Th1038
Therapeutic Peptide/Protein Name	Omalizumab
Sequence	Heavy chain: EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNW view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	145058.2
Chemical Formula	C6450H9916N1714O2023S38
Isoelectric Point	7.03
Hydrophobicity	-0.432
Melting Point (℃)	61(FAB fra
Half Life	624 hours
Description	A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin.
Indication/Disease	For treatment of asthma caused by allergies
Pharmacodynamics	Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma.
Mechanism of Action	Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	78 Â± 32 mL/kg
Clearance	Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/xolair-drug.htm
PubMed ID	27426720, 16810345, 16179960, 28319473, 28314658, 28303277, 28303134, 28302544, 28295198
3-D Structure	Th1038 (View) or (Download)