Detailed description page of THPdb

Details of Th1039 which contains 6 entries.

Entry 1
(1) Primary information
ID 1269
ThPP ID Th1039
Therapeutic Peptide/Protein Name Lutropin alfa
Sequence Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification Ib
Molecular Weight 30000
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life 4.4 hours (mammalian reticulocytes, in vitro)
Description Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease For treatment of female infertility
Pharmacodynamics Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 10 L
Clearance 2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories Fertility Agents
Patents Number US5767251
Date of Issue 16/06/95
Date of Expiry 16/06/15
Drug Interaction Other drugs may interact with lutropin alfa, including prescription and over-the-counter medicines, vitamins, and herbal products
Target Lutropin-choriogonadotropic hormone receptor
Information of corresponding available drug in the market
Brand Name Luveris
Company Serono
Brand Discription Luveris is a purified form of a hormone called luteinizing hormone, or LH. This hormone is important in the development of follicles (eggs) produced by the ovaries in women.
Prescribed for Luveris is used together with follitropin alfa to treat infertility in women with LH deficiency.
Chemical Name N.A.
Formulation One vial contains 75 IU of lutropin alfa (recombinant human Luteinising Hormone {r-hLH}) and following excipeint is present; Powder:Sucrose,Disodium phosphate dihydrate,Sodium dihydrogen phosphate monohydrate,Polysorbate 20,Phosphoric acid, concentrated (
Physcial Appearance White lyophilised pellet withg clear colourless solvent to make solution
Route of Administration Subcutaneous (Subcutaneous) administration
Recommended Dosage It is recommended that 75 IU Luveris be concomitantly administered subcutaneously with 75 IU to 150 IU Gonal-f as two separate injections in the initial treatment cycle
Contraindication Hypersensitivity
Side Effects Nausea, stomach pain, diarrhea, constipation, gas; pelvic pain, menstrual cramps; breast pain; headache; pain or irritation where the injection was given; tired feeling; or cold symptoms such as stuffy nose, sneezing, sore throat.
Useful Link http://www.drugs.com/luveris.html
PubMed ID 20238314, 18627209
3-D Structure Th1039 (View) or (Download)

Entry 2
(2) Primary information
ID 1270
ThPP ID Th1039
Therapeutic Peptide/Protein Name Lutropin alfa
Sequence Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification Ib
Molecular Weight 30000
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life 4.4 hours (mammalian reticulocytes, in vitro)
Description Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease For treatment of female infertility
Pharmacodynamics Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 10 L
Clearance 2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Tumours of the hypothalamus and pituitary gland
Side Effects N.A.
Useful Link http://www.medicines.org.uk/emc/medicine/8289/spc
PubMed ID 20238314, 18627209
3-D Structure Th1039 (View) or (Download)

Entry 3
(3) Primary information
ID 1271
ThPP ID Th1039
Therapeutic Peptide/Protein Name Lutropin alfa
Sequence Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification Ib
Molecular Weight 30000
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life 4.4 hours (mammalian reticulocytes, in vitro)
Description Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease For treatment of female infertility
Pharmacodynamics Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 10 L
Clearance 2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Ovarian enlargement or ovarian cyst unrelated to polycystic ovarian disease and of unknown origin.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20238314, 18627209
3-D Structure Th1039 (View) or (Download)

Entry 4
(4) Primary information
ID 1272
ThPP ID Th1039
Therapeutic Peptide/Protein Name Lutropin alfa
Sequence Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification Ib
Molecular Weight 30000
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life 4.4 hours (mammalian reticulocytes, in vitro)
Description Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease For treatment of female infertility
Pharmacodynamics Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 10 L
Clearance 2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Gynaecological haemorrhages of unknown origin
Side Effects N.A.
Useful Link N.A.
PubMed ID 20238314, 18627209
3-D Structure Th1039 (View) or (Download)

Entry 5
(5) Primary information
ID 1273
ThPP ID Th1039
Therapeutic Peptide/Protein Name Lutropin alfa
Sequence Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification Ib
Molecular Weight 30000
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life 4.4 hours (mammalian reticulocytes, in vitro)
Description Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease For treatment of female infertility
Pharmacodynamics Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 10 L
Clearance 2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Ovarian, uterine, or mammary carcinoma
Side Effects N.A.
Useful Link N.A.
PubMed ID 20238314, 18627209
3-D Structure Th1039 (View) or (Download)

Entry 6
(6) Primary information
ID 1274
ThPP ID Th1039
Therapeutic Peptide/Protein Name Lutropin alfa
Sequence Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification Ib
Molecular Weight 30000
Chemical Formula C1014H1609N287O294S27
Isoelectric Point 8.44
Hydrophobicity -0.063
Melting Point (℃) 55
Half Life 4.4 hours (mammalian reticulocytes, in vitro)
Description Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease For treatment of female infertility
Pharmacodynamics Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution 10 L
Clearance 2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories Fertility Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication Luveris must not be used when a condition exists which would make a normal pregnancy impossible, such as:primary ovarian failure, malformations of sexual organs incompatible with pregnancy, fibroid tumours of the uterus incompatible with pregnancy.
Side Effects N.A.
Useful Link N.A.
PubMed ID 20238314, 18627209
3-D Structure Th1039 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1269
ThPP ID	Th1039
Therapeutic Peptide/Protein Name	Lutropin alfa
Sequence	Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	30000
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	4.4 hours (mammalian reticulocytes, in vitro)
Description	Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease	For treatment of female infertility
Pharmacodynamics	Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action	Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	10 L
Clearance	2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories	Fertility Agents
Patents Number	US5767251
Date of Issue	16/06/95
Date of Expiry	16/06/15
Drug Interaction	Other drugs may interact with lutropin alfa, including prescription and over-the-counter medicines, vitamins, and herbal products
Target	Lutropin-choriogonadotropic hormone receptor
Information of corresponding available drug in the market
Brand Name	Luveris
Company	Serono
Brand Discription	Luveris is a purified form of a hormone called luteinizing hormone, or LH. This hormone is important in the development of follicles (eggs) produced by the ovaries in women.
Prescribed for	Luveris is used together with follitropin alfa to treat infertility in women with LH deficiency.
Chemical Name	N.A.
Formulation	One vial contains 75 IU of lutropin alfa (recombinant human Luteinising Hormone {r-hLH}) and following excipeint is present; Powder:Sucrose,Disodium phosphate dihydrate,Sodium dihydrogen phosphate monohydrate,Polysorbate 20,Phosphoric acid, concentrated (
Physcial Appearance	White lyophilised pellet withg clear colourless solvent to make solution
Route of Administration	Subcutaneous (Subcutaneous) administration
Recommended Dosage	It is recommended that 75 IU Luveris be concomitantly administered subcutaneously with 75 IU to 150 IU Gonal-f as two separate injections in the initial treatment cycle
Contraindication	Hypersensitivity
Side Effects	Nausea, stomach pain, diarrhea, constipation, gas; pelvic pain, menstrual cramps; breast pain; headache; pain or irritation where the injection was given; tired feeling; or cold symptoms such as stuffy nose, sneezing, sore throat.
Useful Link	http://www.drugs.com/luveris.html
PubMed ID	20238314, 18627209
3-D Structure	Th1039 (View) or (Download)

(2) Primary information
Entry 2
ID	1270
ThPP ID	Th1039
Therapeutic Peptide/Protein Name	Lutropin alfa
Sequence	Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	30000
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	4.4 hours (mammalian reticulocytes, in vitro)
Description	Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease	For treatment of female infertility
Pharmacodynamics	Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action	Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	10 L
Clearance	2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Tumours of the hypothalamus and pituitary gland
Side Effects	N.A.
Useful Link	http://www.medicines.org.uk/emc/medicine/8289/spc
PubMed ID	20238314, 18627209
3-D Structure	Th1039 (View) or (Download)

(3) Primary information
Entry 3
ID	1271
ThPP ID	Th1039
Therapeutic Peptide/Protein Name	Lutropin alfa
Sequence	Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	30000
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	4.4 hours (mammalian reticulocytes, in vitro)
Description	Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease	For treatment of female infertility
Pharmacodynamics	Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action	Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	10 L
Clearance	2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Ovarian enlargement or ovarian cyst unrelated to polycystic ovarian disease and of unknown origin.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20238314, 18627209
3-D Structure	Th1039 (View) or (Download)

(4) Primary information
Entry 4
ID	1272
ThPP ID	Th1039
Therapeutic Peptide/Protein Name	Lutropin alfa
Sequence	Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	30000
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	4.4 hours (mammalian reticulocytes, in vitro)
Description	Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease	For treatment of female infertility
Pharmacodynamics	Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action	Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	10 L
Clearance	2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Gynaecological haemorrhages of unknown origin
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20238314, 18627209
3-D Structure	Th1039 (View) or (Download)

(5) Primary information
Entry 5
ID	1273
ThPP ID	Th1039
Therapeutic Peptide/Protein Name	Lutropin alfa
Sequence	Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	30000
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	4.4 hours (mammalian reticulocytes, in vitro)
Description	Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease	For treatment of female infertility
Pharmacodynamics	Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action	Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	10 L
Clearance	2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Ovarian, uterine, or mammary carcinoma
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20238314, 18627209
3-D Structure	Th1039 (View) or (Download)

(6) Primary information
Entry 6
ID	1274
ThPP ID	Th1039
Therapeutic Peptide/Protein Name	Lutropin alfa
Sequence	Alpha Chain: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAY view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	30000
Chemical Formula	C1014H1609N287O294S27
Isoelectric Point	8.44
Hydrophobicity	-0.063
Melting Point (℃)	55
Half Life	4.4 hours (mammalian reticulocytes, in vitro)
Description	Lutropin alfa is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH(LH surge) triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. Lutropin alfa was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development.
Indication/Disease	For treatment of female infertility
Pharmacodynamics	Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone, which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of Action	Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	10 L
Clearance	2-3 L/h [healthy female following subcutaneous administration]. Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Categories	Fertility Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	Luveris must not be used when a condition exists which would make a normal pregnancy impossible, such as:primary ovarian failure, malformations of sexual organs incompatible with pregnancy, fibroid tumours of the uterus incompatible with pregnancy.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	20238314, 18627209
3-D Structure	Th1039 (View) or (Download)