| Entry 1 |
| (1) Primary information |
|---|
| ID | 1305 |
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | 110 to 127 mL/kg [pediatric patients] |
| Clearance | N.A. |
| Categories | Gout Suppressants |
| Patents Number | CA2175971 |
| Date of Issue | 30/12/03 |
| Date of Expiry | 07/05/16 |
| Drug Interaction | amyl nitrite / sodium nitrite / sodium thiosulfate |
| Target | Uric acid |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Elitek |
| Company | Sanofi-Synthelabo Inc |
| Brand Discription | Elitek is a recombinant urate-oxidase produced by a genetically modified Saccharomyces cerevisiae strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. Rasburicase is a tetrameric protein with identical subunits. Each sub |
| Prescribed for | Used for preventing high blood levels of uric acid from occurring in patients with certain types of cancer (eg, leukemia, lymphoma, solid malignant tumors) who are receiving cancer chemotherapy treatment. |
| Chemical Name | N.A. |
| Formulation | Elitek is supplied in 3 mL and 10 mL colorless, glass vials containing rasburicase at a concentration of 1.5 mg/mL after reconstitution. Elitek 1.5 mg presentation contains 1.5 mg rasburicase, 10.6 mg mannitol, 15.9 mg L-alanine, between 12.6 and 14.3 mg |
| Physcial Appearance | Sterile, white to off-white, lyophilized powder |
| Route of Administration | Intravenous administration |
| Recommended Dosage | The recommended dose of Elitek is 0.2 mg/kg as a 30 minute Intravenous infusion daily for up to 5 days. Dosing beyond 5 days or administration of more than one course is not recommended. |
| Contraindication | Pateints with history of anaphylaxic or severe hypersensitivity |
| Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; blue or gray skin color; chest pain; chills; coughing up blood; dark urine; fever; irregular heartbeat; numbness or tingling of the skin; persistent sore throat; severe dizziness; shortness of breath, trouble breathing, or wheezing; swelling of the hands or feet; weakness; yellowing of the eyes and skin. |
| Useful Link | http://www.elitek.us |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |
| Entry 2 |
| (2) Primary information |
|---|
| ID | 1306 |
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | 75.8 to 138 mL/kg [adult patients] |
| Clearance | N.A. |
| Categories | Antihyperuricemic Agents |
| Patents Number | CA2148537 |
| Date of Issue | 16/07/02 |
| Date of Expiry | 03/05/15 |
| Drug Interaction | Citanest Forte (epinephrine / prilocaine) |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | Individulas deficient in glucose -6-phosphate dehydrogenase. |
| Side Effects | N.A. |
| Useful Link | http://www.drugs.com/cdi/elitek.html |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |
| Entry 3 |
| (3) Primary information |
|---|
| ID | 1307 |
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Citanest HCl Plain (prilocaine) |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.rxlist.com/elitek-drug.htm |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |
| Entry 4 |
| (4) Primary information |
|---|
| ID | 1308 |
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Cyanide Antidote Kit (amyl nitrite / sodium nitrite / sodium thiosulfate) |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Fasturtec |
| Company | N.A. |
| Brand Discription | Fasturtec is a medicine that contains the active substance rasburicase. It is a recombinant urate-oxidase enzyme produced by genetically modified Saccharomyces cerevisiae strain. Rasburicase is a tetrameric protein with identical subunits of a molecular |
| Prescribed for | Fasturtec is used to treat and prevent high levels of uric acid in the blood in order to prevent kidney failure. It is used in adults and children with blood cancers who are at risk of a sudden rise in uric acid levels when they start to receive chemother |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | Powder and solvent that are made upto make solution. |
| Route of Administration | Intravenous administartion |
| Recommended Dosage | The recommended dose is 0.2 mg per kilogram body weight in both children and adults, given as a daily infusion for up to seven days. The duration of treatment is adjusted depending on the patient’s blood levels of uric acid and the doctor’s judgment. |
| Contraindication | Hypersensitivity |
| Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; blue or gray skin color; chest pain; chills; coughing up blood; dark urine; fever; irregular heartbeat; numbness or tingling of the skin; persistent sore throat; severe dizziness; shortness of breath, trouble breathing, or wheezing; swelling of the hands or feet; weakness; yellowing of the eyes and skin. |
| Useful Link | http://www.ncbi.nlm.nih.gov/pubmed/15493120 |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |
| Entry 5 |
| (5) Primary information |
|---|
| ID | 1309 |
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Emla (lidocaine / prilocaine topical) |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | Pateint with a deficiency in glucose-6-phoshphate dehydrogenase or other metabolic disorder known to cause haemolytic anaemia. |
| Side Effects | N.A. |
| Useful Link | http://www.drugs.com/uk/fasturtec.html |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |
| Entry 6 |
| (6) Primary information |
|---|
| ID | 1310 |
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Emla Anesthetic Disc (lidocaine / prilocaine topical) |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.medicines.org.uk/emc/medicine/4604 |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |
| Entry 7 |
| (7) Primary information |
|---|
| ID | 1311 |
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | epinephrine / prilocaine |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |
| Entry 8 |
| (8) Primary information |
|---|
| ID | 1312 |
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | lidocaine / prilocaine topical |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |
| Entry 9 |
| (9) Primary information |
|---|
| ID | 1313 |
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Nithiodote (sodium nitrite / sodium thiosulfate) |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |
| Entry 10 |
| (10) Primary information |
|---|
| ID | 1314 |
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Oraqix (lidocaine / prilocaine topical) |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |
| Entry 11 |
| (11) Primary information |
|---|
| ID | 1315 |
| ThPP ID | Th1043 |
| Therapeutic Peptide/Protein Name | Rasburicase |
| Sequence | SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKAD view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting Point (℃) | N.A. |
| Half Life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | sodium nitrite / sodium thiosulfate |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 20445229, 20394650 |
| 3-D Structure | Th1043 (View) or (Download) |