Detailed description page of THPdb

Details of Th1044 which contains 8 entries.

Entry 1
(1) Primary information
ID 1316
ThPP ID Th1044
Therapeutic Peptide/Protein Name Adalimumab
Sequence Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification Ic
Molecular Weight 144190.3
Chemical Formula C6428H9912N1694O1987S46
Isoelectric Point 8.25
Hydrophobicity -0.441
Melting Point (℃) N.A.
Half Life 240-480 hours
Description Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution N.A.
Clearance 12 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories Antirheumatic Agents
Patents Number CA2243459
Date of Issue 17/09/02
Date of Expiry 10/02/17
Drug Interaction Canakinumab and Rilonacept increase immunosuppressive effects and risk of infection.
Target Tumor necrosis factor,Low affinity immunoglobulin gamma Fc region receptor III-B,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Low affinity immunoglobulin gamm
Information of corresponding available drug in the market
Brand Name Humira
Company Abbott Laboratories
Brand Discription HUMIRA is a recombinant human IgG1 monoclonal antibody specific for human tumor necrosis factor. HUMIRA was created using phage display technology resulting in an antibody with human derived heavy and light chain variable regions and human IgG1:k constant
Prescribed for Humira is used to treat rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, and plaque psoriasis. It is also used to treat Crohn's disease or ulcerative colitis, after other drugs have been tried without succe
Chemical Name N.A.
Formulation It is supplied for a single use. Each prefilled syringe delivers 0.8 mL (40 mg) of drug product. Each 0.8 mL of HUMIRA contains 40 mg adalimumab, 4.93 mg sodium chloride, 0.69 mg monobasic sodium phosphate dihydrate, 1.22 mg dibasic sodium phosphate dihyd
Physcial Appearance Sterile, preservative-free solution
Route of Administration Subcutaneous administration
Recommended Dosage The recommended dose of HUMIRA for adult patients with rheumatoid arthritis (RA), psoriatic arthritis (PsA), or ankylosing spondylitis (AS) is 40 mg administered every other week. Methotrexate (MTX), other non-biologic DMARDS, glucocorticoids, nonsteroidal anti-inflammatory drugs (NSAIDs), and/or analgesics may be continued during treatment with HUMIRA.
Contraindication Hypersensitivity
Side Effects Fever, chills, sore throat, vomiting, diarrhea, flu symptoms, pain or burning when you urinate; signs of tuberculosis - fever with ongoing cough, weight loss (fat or muscle); pale skin, easy bruising or bleeding (nosebleeds, bleeding gums); numbness.
Useful Link PDB sequence Link:http://www.rcsb.org/pdb/download/downloadFile.do?fileFormat=FASTA;compression=NO;structureId=1IGT
PubMed ID 25629655, 23620660
3-D Structure Th1044 (View) or (Download)

Entry 2
(2) Primary information
ID 1317
ThPP ID Th1044
Therapeutic Peptide/Protein Name Adalimumab
Sequence Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification Ic
Molecular Weight 144190.3
Chemical Formula C6428H9912N1694O1987S46
Isoelectric Point 8.25
Hydrophobicity -0.441
Melting Point (℃) N.A.
Half Life 240-480 hours
Description Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution N.A.
Clearance 13 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories Anti-Inflammatory Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link Patent Information Link:http://www.freepatentsonline.com/6090382.html
PubMed ID 25629655, 23620660
3-D Structure Th1044 (View) or (Download)

Entry 3
(3) Primary information
ID 1318
ThPP ID Th1044
Therapeutic Peptide/Protein Name Adalimumab
Sequence Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification Ic
Molecular Weight 144190.3
Chemical Formula C6428H9912N1694O1987S46
Isoelectric Point 8.25
Hydrophobicity -0.441
Melting Point (℃) N.A.
Half Life 240-480 hours
Description Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution N.A.
Clearance 14 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories Immunosuppressive Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Adalimumab (and other anti-TNF immunosuppressants), when used in combination with tofacitinib, may increase the risk of added immunosuppression. It is recommended to avoid concurrent therapy.
Target N.A.
Information of corresponding available drug in the market
Brand Name Humira Pen
Company Abbott Laboratories
Brand Discription HUMIRA is a recombinant human IgG1 monoclonal antibody specific for human tumor necrosis factor. HUMIRA was created using phage display technology resulting in an antibody with human derived heavy and light chain variable regions and human IgG1:k constant
Prescribed for It is used to treat rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, and plaque psoriasis. It is also used to treat Crohn's disease or ulcerative colitis, after other drugs have been tried without successfu
Chemical Name N.A.
Formulation N.A.
Physcial Appearance Sterile, preservative-free solution
Route of Administration Subcutaneous Injection
Recommended Dosage The recommended dose of HUMIRA for adult patients with rheumatoid arthritis (RA), psoriatic arthritis (PsA), or ankylosing spondylitis (AS) is 40 mg administered every other week. Methotrexate (MTX), other non-biologic DMARDS, glucocorticoids,nonsteroidal anti-inflammatory drugs (NSAIDs), and/or analgesics may be continued during treatment with HUMIRA.
Contraindication Hypersensitivity
Side Effects Fever, chills, sore throat, vomiting, diarrhea, flu symptoms, pain or burning when you urinate; signs of tuberculosis - fever with ongoing cough, weight loss (fat or muscle); pale skin, easy bruising or bleeding (nosebleeds, bleeding gums); numbness.
Useful Link https://www.humira.com/
PubMed ID 25629655, 23620660
3-D Structure Th1044 (View) or (Download)

Entry 4
(4) Primary information
ID 1319
ThPP ID Th1044
Therapeutic Peptide/Protein Name Adalimumab
Sequence Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification Ic
Molecular Weight 144190.3
Chemical Formula C6428H9912N1694O1987S46
Isoelectric Point 8.25
Hydrophobicity -0.441
Melting Point (℃) N.A.
Half Life 240-480 hours
Description Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution N.A.
Clearance 15 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.webmd.com/drugs/2/drug-144769/humira-pen-subcutaneous/details
PubMed ID 25629655, 23620660
3-D Structure Th1044 (View) or (Download)

Entry 5
(5) Primary information
ID 1320
ThPP ID Th1044
Therapeutic Peptide/Protein Name Adalimumab
Sequence Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification Ic
Molecular Weight 144190.3
Chemical Formula C6428H9912N1694O1987S46
Isoelectric Point 8.25
Hydrophobicity -0.441
Melting Point (℃) N.A.
Half Life 240-480 hours
Description Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution N.A.
Clearance 16 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/mtm/humira-pen.html
PubMed ID 25629655, 23620660
3-D Structure Th1044 (View) or (Download)

Entry 6
(6) Primary information
ID 1321
ThPP ID Th1044
Therapeutic Peptide/Protein Name Adalimumab
Sequence Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification Ic
Molecular Weight 144190.3
Chemical Formula C6428H9912N1694O1987S46
Isoelectric Point 8.25
Hydrophobicity -0.441
Melting Point (℃) N.A.
Half Life 240-480 hours
Description Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution N.A.
Clearance 17 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/humira.html
PubMed ID 25629655, 23620660
3-D Structure Th1044 (View) or (Download)

Entry 7
(7) Primary information
ID 1322
ThPP ID Th1044
Therapeutic Peptide/Protein Name Adalimumab
Sequence Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification Ic
Molecular Weight 144190.3
Chemical Formula C6428H9912N1694O1987S46
Isoelectric Point 8.25
Hydrophobicity -0.441
Melting Point (℃) N.A.
Half Life 240-480 hours
Description Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution N.A.
Clearance 18 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/humira-drug.htm
PubMed ID 25629655, 23620660
3-D Structure Th1044 (View) or (Download)

Entry 8
(8) Primary information
ID 1323
ThPP ID Th1044
Therapeutic Peptide/Protein Name Adalimumab
Sequence Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification Ic
Molecular Weight 144190.3
Chemical Formula C6428H9912N1694O1987S46
Isoelectric Point 8.25
Hydrophobicity -0.441
Melting Point (℃) N.A.
Half Life 240-480 hours
Description Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system.
Absorption N.A.
Volume of Distribution N.A.
Clearance 19 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link https://www.humira.com/
PubMed ID 25629655, 23620660
3-D Structure Th1044 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1316
ThPP ID	Th1044
Therapeutic Peptide/Protein Name	Adalimumab
Sequence	Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	144190.3
Chemical Formula	C6428H9912N1694O1987S46
Isoelectric Point	8.25
Hydrophobicity	-0.441
Melting Point (℃)	N.A.
Half Life	240-480 hours
Description	Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease	For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics	Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action	Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	12 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories	Antirheumatic Agents
Patents Number	CA2243459
Date of Issue	17/09/02
Date of Expiry	10/02/17
Drug Interaction	Canakinumab and Rilonacept increase immunosuppressive effects and risk of infection.
Target	Tumor necrosis factor,Low affinity immunoglobulin gamma Fc region receptor III-B,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Low affinity immunoglobulin gamm
Information of corresponding available drug in the market
Brand Name	Humira
Company	Abbott Laboratories
Brand Discription	HUMIRA is a recombinant human IgG1 monoclonal antibody specific for human tumor necrosis factor. HUMIRA was created using phage display technology resulting in an antibody with human derived heavy and light chain variable regions and human IgG1:k constant
Prescribed for	Humira is used to treat rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, and plaque psoriasis. It is also used to treat Crohn's disease or ulcerative colitis, after other drugs have been tried without succe
Chemical Name	N.A.
Formulation	It is supplied for a single use. Each prefilled syringe delivers 0.8 mL (40 mg) of drug product. Each 0.8 mL of HUMIRA contains 40 mg adalimumab, 4.93 mg sodium chloride, 0.69 mg monobasic sodium phosphate dihydrate, 1.22 mg dibasic sodium phosphate dihyd
Physcial Appearance	Sterile, preservative-free solution
Route of Administration	Subcutaneous administration
Recommended Dosage	The recommended dose of HUMIRA for adult patients with rheumatoid arthritis (RA), psoriatic arthritis (PsA), or ankylosing spondylitis (AS) is 40 mg administered every other week. Methotrexate (MTX), other non-biologic DMARDS, glucocorticoids, nonsteroidal anti-inflammatory drugs (NSAIDs), and/or analgesics may be continued during treatment with HUMIRA.
Contraindication	Hypersensitivity
Side Effects	Fever, chills, sore throat, vomiting, diarrhea, flu symptoms, pain or burning when you urinate; signs of tuberculosis - fever with ongoing cough, weight loss (fat or muscle); pale skin, easy bruising or bleeding (nosebleeds, bleeding gums); numbness.
Useful Link	PDB sequence Link:http://www.rcsb.org/pdb/download/downloadFile.do?fileFormat=FASTA;compression=NO;structureId=1IGT
PubMed ID	25629655, 23620660
3-D Structure	Th1044 (View) or (Download)

(2) Primary information
Entry 2
ID	1317
ThPP ID	Th1044
Therapeutic Peptide/Protein Name	Adalimumab
Sequence	Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	144190.3
Chemical Formula	C6428H9912N1694O1987S46
Isoelectric Point	8.25
Hydrophobicity	-0.441
Melting Point (℃)	N.A.
Half Life	240-480 hours
Description	Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease	For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics	Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action	Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	13 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories	Anti-Inflammatory Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	Patent Information Link:http://www.freepatentsonline.com/6090382.html
PubMed ID	25629655, 23620660
3-D Structure	Th1044 (View) or (Download)

(3) Primary information
Entry 3
ID	1318
ThPP ID	Th1044
Therapeutic Peptide/Protein Name	Adalimumab
Sequence	Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	144190.3
Chemical Formula	C6428H9912N1694O1987S46
Isoelectric Point	8.25
Hydrophobicity	-0.441
Melting Point (℃)	N.A.
Half Life	240-480 hours
Description	Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease	For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics	Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action	Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	14 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories	Immunosuppressive Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Adalimumab (and other anti-TNF immunosuppressants), when used in combination with tofacitinib, may increase the risk of added immunosuppression. It is recommended to avoid concurrent therapy.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	Humira Pen
Company	Abbott Laboratories
Brand Discription	HUMIRA is a recombinant human IgG1 monoclonal antibody specific for human tumor necrosis factor. HUMIRA was created using phage display technology resulting in an antibody with human derived heavy and light chain variable regions and human IgG1:k constant
Prescribed for	It is used to treat rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, and plaque psoriasis. It is also used to treat Crohn's disease or ulcerative colitis, after other drugs have been tried without successfu
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	Sterile, preservative-free solution
Route of Administration	Subcutaneous Injection
Recommended Dosage	The recommended dose of HUMIRA for adult patients with rheumatoid arthritis (RA), psoriatic arthritis (PsA), or ankylosing spondylitis (AS) is 40 mg administered every other week. Methotrexate (MTX), other non-biologic DMARDS, glucocorticoids,nonsteroidal anti-inflammatory drugs (NSAIDs), and/or analgesics may be continued during treatment with HUMIRA.
Contraindication	Hypersensitivity
Side Effects	Fever, chills, sore throat, vomiting, diarrhea, flu symptoms, pain or burning when you urinate; signs of tuberculosis - fever with ongoing cough, weight loss (fat or muscle); pale skin, easy bruising or bleeding (nosebleeds, bleeding gums); numbness.
Useful Link	https://www.humira.com/
PubMed ID	25629655, 23620660
3-D Structure	Th1044 (View) or (Download)

(4) Primary information
Entry 4
ID	1319
ThPP ID	Th1044
Therapeutic Peptide/Protein Name	Adalimumab
Sequence	Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	144190.3
Chemical Formula	C6428H9912N1694O1987S46
Isoelectric Point	8.25
Hydrophobicity	-0.441
Melting Point (℃)	N.A.
Half Life	240-480 hours
Description	Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease	For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics	Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action	Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	15 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.webmd.com/drugs/2/drug-144769/humira-pen-subcutaneous/details
PubMed ID	25629655, 23620660
3-D Structure	Th1044 (View) or (Download)

(5) Primary information
Entry 5
ID	1320
ThPP ID	Th1044
Therapeutic Peptide/Protein Name	Adalimumab
Sequence	Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	144190.3
Chemical Formula	C6428H9912N1694O1987S46
Isoelectric Point	8.25
Hydrophobicity	-0.441
Melting Point (℃)	N.A.
Half Life	240-480 hours
Description	Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease	For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics	Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action	Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	16 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/mtm/humira-pen.html
PubMed ID	25629655, 23620660
3-D Structure	Th1044 (View) or (Download)

(6) Primary information
Entry 6
ID	1321
ThPP ID	Th1044
Therapeutic Peptide/Protein Name	Adalimumab
Sequence	Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	144190.3
Chemical Formula	C6428H9912N1694O1987S46
Isoelectric Point	8.25
Hydrophobicity	-0.441
Melting Point (℃)	N.A.
Half Life	240-480 hours
Description	Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease	For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics	Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action	Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	17 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/humira.html
PubMed ID	25629655, 23620660
3-D Structure	Th1044 (View) or (Download)

(7) Primary information
Entry 7
ID	1322
ThPP ID	Th1044
Therapeutic Peptide/Protein Name	Adalimumab
Sequence	Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	144190.3
Chemical Formula	C6428H9912N1694O1987S46
Isoelectric Point	8.25
Hydrophobicity	-0.441
Melting Point (℃)	N.A.
Half Life	240-480 hours
Description	Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease	For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics	Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action	Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	18 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/humira-drug.htm
PubMed ID	25629655, 23620660
3-D Structure	Th1044 (View) or (Download)

(8) Primary information
Entry 8
ID	1323
ThPP ID	Th1044
Therapeutic Peptide/Protein Name	Adalimumab
Sequence	Light-chain:DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQ view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	144190.3
Chemical Formula	C6428H9912N1694O1987S46
Isoelectric Point	8.25
Hydrophobicity	-0.441
Melting Point (℃)	N.A.
Half Life	240-480 hours
Description	Adalimumab(1330 amino acids, molecular weight of approximately 148 kilodaltons) is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system.
Indication/Disease	For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Pharmacodynamics	Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of Action	Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	19 mL/hr [RA patients with dose 0.25-10 mg/kg]
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	https://www.humira.com/
PubMed ID	25629655, 23620660
3-D Structure	Th1044 (View) or (Download)