Detailed description page of THPdb

Details of Th1048 which contains 4 entries.

Entry 1
(1) Primary information
ID 1337
ThPP ID Th1048
Therapeutic Peptide/Protein Name Pegaspargase
Sequence MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVG view full sequnce in fasta
Functional Classification Ic
Molecular Weight 31731.9
Chemical Formula C1377H2208N382O442S17
Isoelectric Point 4.67
Hydrophobicity 0.059
Melting Point (℃) N.A.
Half Life N.A.
Description Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life.
Indication/Disease For treatment of acute lymphoblastic leukemia.
Pharmacodynamics In a significant number of patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Oncaspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action Pegaspargase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Antineoplastic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target L-asparagine
Information of corresponding available drug in the market
Brand Name Oncaspar
Company Enzon Inc
Brand Discription Oncaspar (pegaspargase) is L-asparaginase (L-asparagine amidohydrolase) that is covalently conjugated to monomethoxypolyethylene glycol (mPEG). L-asparaginase is a tetrameric enzyme that is produced endogenously by E. coli and consists of identical 34.5 k
Prescribed for Oncaspar is indicated as a component of a multi-agent chemotherapeutic regimen for the first line treatment of patients with Acute Lymphoblastic Leukemia (ALL).
Chemical Name N.A.
Formulation Oncaspar is supplied as a clear, colorless, preservative-free, isotonic sterile solution in phosphate-buffered saline, pH 7.3. Each milliliter contains 750 Â± 150 International Units of pegaspargase, dibasic sodium phosphate, USP (5.58 mg), monobasic sodiu
Physcial Appearance Solution
Route of Administration Intravenous or intramuSubcutaneousular administrat
Recommended Dosage The recommended dose of Oncaspar is 2,500 International Units/m_ intramuscularly or intravenously. Oncaspar should be administered no more frequently than every 14 days. When Oncaspar is administered intramuscularly, the volume at a single injection site should be limited to 2ml.
Contraindication History of serious allergic reactions to Oncaspar. History of serious thrombosis with prior L-asparaginase therapy. History of pancreatitis with prior L-asparaginase therapy. History of serious hemorrhagic events with prior L-asparaginase therapy.
Side Effects Hypersensitivity reactions, coagulopathy, hyperglycemia, elevated serum transaminase concentrations, hyperbilirubinemia, pancreatitis, CNS thrombosis.No apparent difference in adverse effects following IV versus IM administration.
Useful Link http://www.fda.gov/AboutFDA/CentersOffices/OfficeofMedicalProductsandTobacco/CDER/ucm095609.htm
PubMed ID 14499708, 23794007
3-D Structure Th1048 (View) or (Download)

Entry 2
(2) Primary information
ID 1338
ThPP ID Th1048
Therapeutic Peptide/Protein Name Pegaspargase
Sequence MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVG view full sequnce in fasta
Functional Classification Ic
Molecular Weight 31731.9
Chemical Formula C1377H2208N382O442S17
Isoelectric Point 4.67
Hydrophobicity 0.059
Melting Point (℃) N.A.
Half Life N.A.
Description Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life.
Indication/Disease For treatment of acute lymphoblastic leukemia
Pharmacodynamics In a significant number of patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Oncaspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action Pegaspargase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Antineoplastic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.oncaspar.com/
PubMed ID 14499708, 23794007
3-D Structure Th1048 (View) or (Download)

Entry 3
(3) Primary information
ID 1339
ThPP ID Th1048
Therapeutic Peptide/Protein Name Pegaspargase
Sequence MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVG view full sequnce in fasta
Functional Classification Ic
Molecular Weight 31731.9
Chemical Formula C1377H2208N382O442S17
Isoelectric Point 4.67
Hydrophobicity 0.059
Melting Point (℃) N.A.
Half Life N.A.
Description Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life.
Indication/Disease For treatment of acute lymphoblastic leukemia
Pharmacodynamics In a significant number of patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Oncaspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action Pegaspargase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Antineoplastic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.rxlist.com/oncaspar-drug.htm
PubMed ID 14499708, 23794007
3-D Structure Th1048 (View) or (Download)

Entry 4
(4) Primary information
ID 1340
ThPP ID Th1048
Therapeutic Peptide/Protein Name Pegaspargase
Sequence MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVG view full sequnce in fasta
Functional Classification Ic
Molecular Weight 31731.9
Chemical Formula C1377H2208N382O442S17
Isoelectric Point 4.67
Hydrophobicity 0.059
Melting Point (℃) N.A.
Half Life N.A.
Description Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life.
Indication/Disease For treatment of acute lymphoblastic leukemia
Pharmacodynamics In a significant number of patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Oncaspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action Pegaspargase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Antineoplastic Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.drugs.com/monograph/oncaspar.html
PubMed ID 14499708, 23794007
3-D Structure Th1048 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1337
ThPP ID	Th1048
Therapeutic Peptide/Protein Name	Pegaspargase
Sequence	MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVG view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	31731.9
Chemical Formula	C1377H2208N382O442S17
Isoelectric Point	4.67
Hydrophobicity	0.059
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life.
Indication/Disease	For treatment of acute lymphoblastic leukemia.
Pharmacodynamics	In a significant number of patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Oncaspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action	Pegaspargase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antineoplastic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target	L-asparagine
Information of corresponding available drug in the market
Brand Name	Oncaspar
Company	Enzon Inc
Brand Discription	Oncaspar (pegaspargase) is L-asparaginase (L-asparagine amidohydrolase) that is covalently conjugated to monomethoxypolyethylene glycol (mPEG). L-asparaginase is a tetrameric enzyme that is produced endogenously by E. coli and consists of identical 34.5 k
Prescribed for	Oncaspar is indicated as a component of a multi-agent chemotherapeutic regimen for the first line treatment of patients with Acute Lymphoblastic Leukemia (ALL).
Chemical Name	N.A.
Formulation	Oncaspar is supplied as a clear, colorless, preservative-free, isotonic sterile solution in phosphate-buffered saline, pH 7.3. Each milliliter contains 750 Â± 150 International Units of pegaspargase, dibasic sodium phosphate, USP (5.58 mg), monobasic sodiu
Physcial Appearance	Solution
Route of Administration	Intravenous or intramuSubcutaneousular administrat
Recommended Dosage	The recommended dose of Oncaspar is 2,500 International Units/m_ intramuscularly or intravenously. Oncaspar should be administered no more frequently than every 14 days. When Oncaspar is administered intramuscularly, the volume at a single injection site should be limited to 2ml.
Contraindication	History of serious allergic reactions to Oncaspar. History of serious thrombosis with prior L-asparaginase therapy. History of pancreatitis with prior L-asparaginase therapy. History of serious hemorrhagic events with prior L-asparaginase therapy.
Side Effects	Hypersensitivity reactions, coagulopathy, hyperglycemia, elevated serum transaminase concentrations, hyperbilirubinemia, pancreatitis, CNS thrombosis.No apparent difference in adverse effects following IV versus IM administration.
Useful Link	http://www.fda.gov/AboutFDA/CentersOffices/OfficeofMedicalProductsandTobacco/CDER/ucm095609.htm
PubMed ID	14499708, 23794007
3-D Structure	Th1048 (View) or (Download)

(2) Primary information
Entry 2
ID	1338
ThPP ID	Th1048
Therapeutic Peptide/Protein Name	Pegaspargase
Sequence	MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVG view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	31731.9
Chemical Formula	C1377H2208N382O442S17
Isoelectric Point	4.67
Hydrophobicity	0.059
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life.
Indication/Disease	For treatment of acute lymphoblastic leukemia
Pharmacodynamics	In a significant number of patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Oncaspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action	Pegaspargase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antineoplastic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.oncaspar.com/
PubMed ID	14499708, 23794007
3-D Structure	Th1048 (View) or (Download)

(3) Primary information
Entry 3
ID	1339
ThPP ID	Th1048
Therapeutic Peptide/Protein Name	Pegaspargase
Sequence	MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVG view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	31731.9
Chemical Formula	C1377H2208N382O442S17
Isoelectric Point	4.67
Hydrophobicity	0.059
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life.
Indication/Disease	For treatment of acute lymphoblastic leukemia
Pharmacodynamics	In a significant number of patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Oncaspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action	Pegaspargase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antineoplastic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.rxlist.com/oncaspar-drug.htm
PubMed ID	14499708, 23794007
3-D Structure	Th1048 (View) or (Download)

(4) Primary information
Entry 4
ID	1340
ThPP ID	Th1048
Therapeutic Peptide/Protein Name	Pegaspargase
Sequence	MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVG view full sequnce in fasta
Functional Classification	Ic
Molecular Weight	31731.9
Chemical Formula	C1377H2208N382O442S17
Isoelectric Point	4.67
Hydrophobicity	0.059
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life.
Indication/Disease	For treatment of acute lymphoblastic leukemia
Pharmacodynamics	In a significant number of patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Oncaspar exploits a metabolic defect in asparagine synthesis of some malignant cells.
Mechanism of Action	Pegaspargase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Antineoplastic Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.drugs.com/monograph/oncaspar.html
PubMed ID	14499708, 23794007
3-D Structure	Th1048 (View) or (Download)