| Entry 1 |
| (1) Primary information |
|---|
| ID | 1358 |
| ThPP ID | Th1050 |
| Therapeutic Peptide/Protein Name | Pegademase bovine |
| Sequence | MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNII view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine 2-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Enzyme Replacement Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Krystexxa (pegloticase) |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Adagen |
| Company | Enzon Inc. |
| Brand Discription | Adagen is a modified enzyme. It is a conjugate of numerous strands of monomethoxypolyethylene glycol (PEG), molecular weight 5,000, covalently attached to the enzyme adenosine deaminase (ADA). ADA (adenosine deaminase EC 3.5.4.4) used in the manufacture |
| Prescribed for | It is used for Treating severe combined immunodeficiency disease (SCID) in certain patients with adenosine deaminase (ADA) deficiency. |
| Chemical Name | (monomethoxypolyethylene glycol succinimidyl) 11-17_ adenosine deaminase |
| Formulation | Each ml of ADAGEN injection contains, 250 units of Pegademase bovine, 20 mg of Monobasic sodium phoshphate, USP, 5.58 mg of Dibasic sodium phoshphate, USP, 8.50 mg of Sodiium chloride, USP and q.s. to 0 ml of water for injection. |
| Physcial Appearance | Isotonic, pyrogen free, Sterile solution, pH 7.2-7.4 |
| Route of Administration | Intramusular Injection |
| Recommended Dosage | The dosage of ADAGEN (pegademase bovine) Injection should be individualized. The recommended dosing schedule is 10 U/kg for the first dose, 15 U/kg for the second dose, and 20 U/kg for the third dose. The usual maintenance dose is 20 U/kg per week. Further increases of 5 U/kg/week may be necessary, but a maximum single dose of 30 U/kg should not be exceeded. |
| Contraindication | Allergic |
| Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; dark urine; severe or persistent tiredness or weakness; unusual bruising or bleeding |
| Useful Link | http://www.adagen.com/ |
| PubMed ID | 18778113, 19707420, 18778113, 8160672, 1803799 |
| 3-D Structure | Th1050 (View) or (Download) |
| Entry 2 |
| (2) Primary information |
|---|
| ID | 1359 |
| ThPP ID | Th1050 |
| Therapeutic Peptide/Protein Name | Pegademase bovine |
| Sequence | MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNII view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine 2-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Enzyme Replacement Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Pegloticase |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | Headache; pain or redness at the injection site. |
| Useful Link | http://www.drugs.com/dosage/adagen.html |
| PubMed ID | 18778113, 19707420, 18778113, 8160672, 1803799 |
| 3-D Structure | Th1050 (View) or (Download) |
| Entry 3 |
| (3) Primary information |
|---|
| ID | 1360 |
| ThPP ID | Th1050 |
| Therapeutic Peptide/Protein Name | Pegademase bovine |
| Sequence | MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNII view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine 2-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Enzyme Replacement Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | http://www.accessdata.fda.gov/drugsatfda_docs/label/2008/019818s042lbl.pdf |
| PubMed ID | 18778113, 19707420, 18778113, 8160672, 1803799 |
| 3-D Structure | Th1050 (View) or (Download) |