Detailed description page of THPdb

Details of Th1050 which contains 3 entries.

Entry 1
(1) Primary information
ID 1358
ThPP ID Th1050
Therapeutic Peptide/Protein Name Pegademase bovine
Sequence MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNII view full sequnce in fasta
Functional Classification Ia
Molecular Weight 40788.2
Chemical Formula C1821H2834N484O552S14
Isoelectric Point 5.33
Hydrophobicity -0.428
Melting Point (℃) N.A.
Half Life N.A.
Description Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life.
Indication/Disease For treatment of adenosine deaminase deficiency
Pharmacodynamics Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine 2-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function.
Mechanism of Action Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Enzyme Replacement Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Krystexxa (pegloticase)
Target Adenosine,Growth factor receptor-bound protein 2
Information of corresponding available drug in the market
Brand Name Adagen
Company Enzon Inc.
Brand Discription Adagen is a modified enzyme. It is a conjugate of numerous strands of monomethoxypolyethylene glycol (PEG), molecular weight 5,000, covalently attached to the enzyme adenosine deaminase (ADA). ADA (adenosine deaminase EC 3.5.4.4) used in the manufacture
Prescribed for It is used for Treating severe combined immunodeficiency disease (SCID) in certain patients with adenosine deaminase (ADA) deficiency.
Chemical Name (monomethoxypolyethylene glycol succinimidyl) 11-17_ adenosine deaminase
Formulation Each ml of ADAGEN injection contains, 250 units of Pegademase bovine, 20 mg of Monobasic sodium phoshphate, USP, 5.58 mg of Dibasic sodium phoshphate, USP, 8.50 mg of Sodiium chloride, USP and q.s. to 0 ml of water for injection.
Physcial Appearance Isotonic, pyrogen free, Sterile solution, pH 7.2-7.4
Route of Administration Intramusular Injection
Recommended Dosage The dosage of ADAGEN (pegademase bovine) Injection should be individualized. The recommended dosing schedule is 10 U/kg for the first dose, 15 U/kg for the second dose, and 20 U/kg for the third dose. The usual maintenance dose is 20 U/kg per week. Further increases of 5 U/kg/week may be necessary, but a maximum single dose of 30 U/kg should not be exceeded.
Contraindication Allergic
Side Effects Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; dark urine; severe or persistent tiredness or weakness; unusual bruising or bleeding
Useful Link http://www.adagen.com/
PubMed ID 18778113, 19707420, 18778113, 8160672, 1803799
3-D Structure Th1050 (View) or (Download)

Entry 2
(2) Primary information
ID 1359
ThPP ID Th1050
Therapeutic Peptide/Protein Name Pegademase bovine
Sequence MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNII view full sequnce in fasta
Functional Classification Ia
Molecular Weight 40788.2
Chemical Formula C1821H2834N484O552S14
Isoelectric Point 5.33
Hydrophobicity -0.428
Melting Point (℃) N.A.
Half Life N.A.
Description Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life.
Indication/Disease For treatment of adenosine deaminase deficiency
Pharmacodynamics Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine 2-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function.
Mechanism of Action Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Enzyme Replacement Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction Pegloticase
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects Headache; pain or redness at the injection site.
Useful Link http://www.drugs.com/dosage/adagen.html
PubMed ID 18778113, 19707420, 18778113, 8160672, 1803799
3-D Structure Th1050 (View) or (Download)

Entry 3
(3) Primary information
ID 1360
ThPP ID Th1050
Therapeutic Peptide/Protein Name Pegademase bovine
Sequence MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNII view full sequnce in fasta
Functional Classification Ia
Molecular Weight 40788.2
Chemical Formula C1821H2834N484O552S14
Isoelectric Point 5.33
Hydrophobicity -0.428
Melting Point (℃) N.A.
Half Life N.A.
Description Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life.
Indication/Disease For treatment of adenosine deaminase deficiency
Pharmacodynamics Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine 2-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function.
Mechanism of Action Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination.
Toxicity N.A.
Metabolism N.A.
Absorption N.A.
Volume of Distribution N.A.
Clearance N.A.
Categories Enzyme Replacement Agents
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link http://www.accessdata.fda.gov/drugsatfda_docs/label/2008/019818s042lbl.pdf
PubMed ID 18778113, 19707420, 18778113, 8160672, 1803799
3-D Structure Th1050 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1358
ThPP ID	Th1050
Therapeutic Peptide/Protein Name	Pegademase bovine
Sequence	MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNII view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	40788.2
Chemical Formula	C1821H2834N484O552S14
Isoelectric Point	5.33
Hydrophobicity	-0.428
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life.
Indication/Disease	For treatment of adenosine deaminase deficiency
Pharmacodynamics	Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine 2-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function.
Mechanism of Action	Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Enzyme Replacement Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Krystexxa (pegloticase)
Target	Adenosine,Growth factor receptor-bound protein 2
Information of corresponding available drug in the market
Brand Name	Adagen
Company	Enzon Inc.
Brand Discription	Adagen is a modified enzyme. It is a conjugate of numerous strands of monomethoxypolyethylene glycol (PEG), molecular weight 5,000, covalently attached to the enzyme adenosine deaminase (ADA). ADA (adenosine deaminase EC 3.5.4.4) used in the manufacture
Prescribed for	It is used for Treating severe combined immunodeficiency disease (SCID) in certain patients with adenosine deaminase (ADA) deficiency.
Chemical Name	(monomethoxypolyethylene glycol succinimidyl) 11-17_ adenosine deaminase
Formulation	Each ml of ADAGEN injection contains, 250 units of Pegademase bovine, 20 mg of Monobasic sodium phoshphate, USP, 5.58 mg of Dibasic sodium phoshphate, USP, 8.50 mg of Sodiium chloride, USP and q.s. to 0 ml of water for injection.
Physcial Appearance	Isotonic, pyrogen free, Sterile solution, pH 7.2-7.4
Route of Administration	Intramusular Injection
Recommended Dosage	The dosage of ADAGEN (pegademase bovine) Injection should be individualized. The recommended dosing schedule is 10 U/kg for the first dose, 15 U/kg for the second dose, and 20 U/kg for the third dose. The usual maintenance dose is 20 U/kg per week. Further increases of 5 U/kg/week may be necessary, but a maximum single dose of 30 U/kg should not be exceeded.
Contraindication	Allergic
Side Effects	Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; dark urine; severe or persistent tiredness or weakness; unusual bruising or bleeding
Useful Link	http://www.adagen.com/
PubMed ID	18778113, 19707420, 18778113, 8160672, 1803799
3-D Structure	Th1050 (View) or (Download)

(2) Primary information
Entry 2
ID	1359
ThPP ID	Th1050
Therapeutic Peptide/Protein Name	Pegademase bovine
Sequence	MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNII view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	40788.2
Chemical Formula	C1821H2834N484O552S14
Isoelectric Point	5.33
Hydrophobicity	-0.428
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life.
Indication/Disease	For treatment of adenosine deaminase deficiency
Pharmacodynamics	Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine 2-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function.
Mechanism of Action	Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Enzyme Replacement Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	Pegloticase
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	Headache; pain or redness at the injection site.
Useful Link	http://www.drugs.com/dosage/adagen.html
PubMed ID	18778113, 19707420, 18778113, 8160672, 1803799
3-D Structure	Th1050 (View) or (Download)

(3) Primary information
Entry 3
ID	1360
ThPP ID	Th1050
Therapeutic Peptide/Protein Name	Pegademase bovine
Sequence	MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNII view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	40788.2
Chemical Formula	C1821H2834N484O552S14
Isoelectric Point	5.33
Hydrophobicity	-0.428
Melting Point (℃)	N.A.
Half Life	N.A.
Description	Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life.
Indication/Disease	For treatment of adenosine deaminase deficiency
Pharmacodynamics	Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine 2-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function.
Mechanism of Action	Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination.
Toxicity	N.A.
Metabolism	N.A.
Absorption	N.A.
Volume of Distribution	N.A.
Clearance	N.A.
Categories	Enzyme Replacement Agents
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	http://www.accessdata.fda.gov/drugsatfda_docs/label/2008/019818s042lbl.pdf
PubMed ID	18778113, 19707420, 18778113, 8160672, 1803799
3-D Structure	Th1050 (View) or (Download)