A database of FDA approved therapeutic peptides and proteins
Details of Th1051 which contains 2 entries. |
| Entry 1 | |
| (1) Primary information | |
|---|---|
| ID | 1361 |
| ThPP ID | Th1051 |
| Therapeutic Peptide/Protein Name | Human Serum Albumin |
| Sequence | MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 66472.2 |
| Chemical Formula | C2936H4624N786O889S41 |
| Isoelectric Point | 5.67 |
| Hydrophobicity | -0.395 |
| Melting Point (℃) | 62 |
| Half Life | N.A. |
| Description | Human serum albumin isolated from expired blood plasma. |
| Indication/Disease | Human Serum Albumin is indicated for treatment of severe blood loss, hypervolemia, hypoproteinemia. |
| Pharmacodynamics | Human Serum Albumin regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation. |
| Mechanism of Action | Human Serum albumin acts as a high molecular weight, very soluble osmolyte. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Serum substitutes |
| Patents Number | US6723303 |
| Date of Issue | 21/04/05 |
| Date of Expiry | 21/04/25 |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | Albuminar |
| Company | CSL Behring |
| Brand Discription | Albuminar is a sterile aqueous solution of albumin obtained from large pools of adult human venous plasmaby low temperature controlled fractionation according to the Cohn process. It is stabilized with 0.02 M sodium acetyltryptophanate and 0.02 M sodium caprylate and pasteurized at 60 for 10 hours. |
| Prescribed for | precscribed in treatment of Shock, Burns, Hypoproteinemia with or without edema |
| Chemical Name | N.A. |
| Formulation | Albumin (Human) 25% (albumin human) is a solution containing in each 100 mL, 25 grams of serum albumin, osmotically equivalent to 500 mL of normal human plasma. The pH of the solution is adjusted with sodium bicarbonate, sodium hydroxide, or acetic acid. Approximate concentrations of significant electrolytes per liter are: sodium - 130-160 mEq; and potassium - n.m.t. 1 mEq. |
| Physcial Appearance | Albumin (Human) 25%, is a Sterile aqueous solution of albumin obtained from large pools of adult human venous plasma by low temperature controlled fractionation according to the Cohn process. |
| Route of Administration | Albumin (Human) 25%, Albuminar-25 (albumin human) |
| Recommended Dosage | Albumin (Human) 25%, Albuminar-25 (albumin (human)) may be given intravenously without dilution or it may be diluted with normal saline or 5% dextrose before administration. 200 mL per liter gives a solution which is approximately isotonic and iso-osmotic with citrated plasma. |
| Contraindication | Albumin (Human) 25% may be contraindicated in patients with severe anemia or cardiac failure and in patients with a history of allergic reactions to human albumin. |
| Side Effects | Allergic or pyrogenic reactions are characterized primarily by fever and chills; rash, nausea, vomiting, tachycardia and hypotension have also been reported. if administered rapidly, may result in vascular overload with resultant pulmonary edema. |
| Useful Link | http://www.rxlist.com/albuminar-drug.htm |
| PubMed ID | 12846933, 9675210 |
| 3-D Structure | Th1051 (View) or (Download) |
| Entry 2 | |
| (2) Primary information | |
|---|---|
| ID | 1362 |
| ThPP ID | Th1051 |
| Therapeutic Peptide/Protein Name | Human Serum Albumin |
| Sequence | MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIA view full sequnce in fasta |
| Functional Classification | Ia |
| Molecular Weight | 66472.2 |
| Chemical Formula | C2936H4624N786O889S41 |
| Isoelectric Point | 5.67 |
| Hydrophobicity | -0.395 |
| Melting Point (℃) | 62 |
| Half Life | N.A. |
| Description | Human serum albumin isolated from expired blood plasma. |
| Indication/Disease | Human Serum Albumin is indicated for treatment of severe blood loss, hypervolemia, hypoproteinemia. |
| Pharmacodynamics | Human Serum Albumin regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation. |
| Mechanism of Action | Human Serum albumin acts as a high molecular weight, very soluble osmolyte. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Serum substitutes |
| Patents Number | US5558094 |
| Date of Issue | 01/03/99 |
| Date of Expiry | 29/02/16 |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | Albutein |
| Company | GRIFOLS |
| Brand Discription | Albutein is a concentrate of plasma proteins from human blood. It works by increasing plasma volume or serum albumin levels. |
| Prescribed for | For treatment of hypovolemic shock,As an adjunct in hemodialysis for patients undergoing long-term dialysis or for those patients who are fluid-overloaded and cannot tolerate substantial volumes of salt solution for therapy of shock or hypotension |
| Chemical Name | N.A. |
| Formulation | Albutein 20% is clinically desirable, compatible diluents include sterile 0.9% Sodium Chloride solution or sterile 5% Dextrose in Water. |
| Physcial Appearance | Albutein 20% is a Sterile, aqueous solution for single dose intravenous administration containing 20% human albumin (weight/volume). |
| Route of Administration | Albutein 20% is to be administered by the Intraven |
| Recommended Dosage | Albutein 20% is administered intravenously. The total dosage will vary with the individual. In adults, an initial infusion of 100 mL is suggested. |
| Contraindication | Albutein 20% is contraindicated in patients with severe anemia or cardiac failure in the presence of normal or increased intravascular volume. |
| Side Effects | The most common adverse reactions include fever and chills, rash, nausea, vomiting, tachycardia and hypotension. Should an adverse reaction occur, slow or stop the infusion for a short period of time which may result in the disappearance of the symptoms. If administration has been stopped and the patient requires additional Albutein 20%, material from a different lot should be used. |
| Useful Link | Peters, T., Jr., Serum Albumin in:Â The Plasma Proteins, 2nd Ed., Putnam F.W. (ed), New York, Academic Press, 1:133-181, 1975. Finlayson, J.S., Albumin Products Semin Thromb Hemo, 6:85-120, 1980. |
| PubMed ID | 12846933, 9675210 |
| 3-D Structure | Th1051 (View) or (Download) |