A database of FDA approved therapeutic peptides and proteins
Details of Th1059 which contains 1 entries. |
| Entry 1 | |
| (1) Primary information | |
|---|---|
| ID | 1381 |
| ThPP ID | Th1059 |
| Therapeutic Peptide/Protein Name | Hyaluronidase |
| Sequence | MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPR view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 53870.9 |
| Chemical Formula | C2455H3775N617O704S21 |
| Isoelectric Point | 5.73 |
| Hydrophobicity | -0.117 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Highly purified sheep hyaluronidase for administration by injection into the vitreous of the eye. |
| Indication/Disease | For increase of absorption and distribution of other injected drugs and for rehydration. |
| Pharmacodynamics | Hyaluronidase hydrolyzes hyaluronic acid and increase diffusion of injected drugs, thus facilitating their absorption. Hyaluronidase is used for enhancing absorption and distribution of other injected drugs. |
| Mechanism of Action | Hyaluronidase is a spreading or diffusing substance. It increase the permeability of connective tissue through the hydrolysis of hyaluronic acid. Hyaluronidase hydrolyzes hyaluronic acid by splitting the glucosaminidic bond between C1 of the glucosamine moiety and C4 of glucuronic acid. This temporarily decreases the viscosity of the cellular cement and increases diffusion of injected fluids or of localized transudates or exudates, thus facilitating their absorption. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Adjuvants, Anesthesia and Permeabilizing Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | HYLENEX |
| Company | Baxter Healthcare Corporation |
| Brand Discription | HYLENEX recombinant (hyaluronidase human injection) is a purified preparation of the enzyme recombinant human hyaluronidase |
| Prescribed for | HYLENEX recombinant is indicated as an adjuvant in subcutaneous fluid administration for achieving hydration, to increase the dispersion and absorption of other injected drug and an adjunct in subcutaneous urography for improving resorption of radioopque agents |
| Chemical Name | N.A. |
| Formulation | Each mL contains 150 USP units of recombinant human hyaluronidase with 8.5 mg sodium chloride, 1.4 mg dibasic sodium phosphate, 1.0 mg albumin human, 0.9 mg edentate disodium, 0.3 mg calcium chloride, and sodium hydroxide added for pH adjustment. |
| Physcial Appearance | HYLENEX recombinant (hyaluronidase human injection) is supplied as a Sterile, clear, colorless, nonpreserved, ready for use solution. |
| Route of Administration | human Injection Subcutaneous use |
| Recommended Dosage | Most typically 150 U hyaluronidaseare used to the injection (hyaluronidase human injection) for the subcutaneous fluid administration, will facilitate absorption of 1,000 mL or more of solution. |
| Contraindication | HYLENEX is contraindicated in patients with known hypersensitivity to hyaluronidase or any of the excipients |
| Side Effects | adverse experiences have been mild local injection site reactions such as erythema and pain. Edema has been reported most frequently. |
| Useful Link | http://www.rxlist.com/hylenex-drug.htm, http://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=1e547159-daa7-4b5d-9ad5-5261ea866e13 |
| PubMed ID | 10493834 |
| 3-D Structure | Th1059 (View) or (Download) |