A database of FDA approved therapeutic peptides and proteins
Details of Th1061 which contains 4 entries. |
| Entry 1 | |
| (1) Primary information | |
|---|---|
| ID | 1385 |
| ThPP ID | Th1061 |
| Therapeutic Peptide/Protein Name | Trastuzumab |
| Sequence | Light chain 1: DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAW view full sequnce in fasta |
| Functional Classification | IIa |
| Molecular Weight | 145531.5 |
| Chemical Formula | C6470H10012N1726O2013S42 |
| Isoelectric Point | 8.45 |
| Hydrophobicity | -0.415 |
| Melting Point (℃) | 61 (FAB f |
| Half Life | average 28.5 days |
| Description | A recombinant IgG1 kappa, humanized monoclonal antibody that selectively binds with high affinity in a cell-based assay (Kd = 5 nM) to the extracellular domain of the human epidermal growth factor receptor protein. Produced in CHO cell culture. |
| Indication/Disease | For treatment of early stage HER2-positive breast cancer, or metastatic breast cancer that substantially overexpress HER2. |
| Pharmacodynamics | Used in the treatment of HER2-positive breast cancer. HER2 protein overexpression is observed in 25%-30% of primary breast cancers.Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumorcells that overexpress HER2. It is a mediator of antibody dependent cellular cytotoxicity, in that the binding of the antibody to HER2 overexpressing cells leads to preferential cell death. |
| Mechanism of Action | Trastuzumab binds to the HER2 (or c-erbB2) proto-oncogene, an EGF receptor-like protein found on 20-30% of breast cancer cells. The binding leads to antibody mediated (complement mediated) killing of the HER2 positive cells. |
| Toxicity | Administration of trastuzumab can result in ventricular dysfunction and congestive heart failure. Risk of cardiotocity is especially elevated in patients recieving concurrent anthracycline or cyclophosphamide therapy. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | 44 mL/kg |
| Clearance | N.A. |
| Categories | Antineoplastic Agents |
| Patents Number | CA2103059 |
| Date of Issue | 23/03/09 |
| Date of Expiry | 16/06/16 |
| Drug Interaction | Abciximab may increase the risk of a hypersensitivy reaction to Trastuzumab |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | Herceptin |
| Company | Genentech |
| Brand Discription | Herceptin (trastuzumab) is a humanized IgG1 kappa monoclonal antibody that selectively binds with high affinity to the extracellular domain of the human epidermal growth factor receptor 2 protein, HER2. Trastuzumab is produced by recombinant DNA technology in a mammalian cell (Chinese Hamster Ovary) culture containing the antibiotic gentamicin |
| Prescribed for | Adjuvant Breast Cancer, Metastatic Breast Cancer, Metastatic Gastric Cancer |
| Chemical Name | N.A. |
| Formulation | Each multi-use vial of Herceptin contains 440 mg trastuzumab, 400 mg a,a-trehalose dihydrate, 9.9 mg L-histidine HCl, 6.4 mg L-histidine, and 1.8 mg polysorbate 20, USP. Reconstitution with 20 mL of the appropriate diluent (BWFI or SWFI) yields a solution containing 21 mg/mL trastuzumab, at a pH of approximately 6 |
| Physcial Appearance | Herceptin is a sterile, white to pale yellow, preservative-free lyophilized powder |
| Route of Administration | Â Intravenous administration |
| Recommended Dosage | Initial dose of 4mg/kg for 90 minutes and after that 2mg/kg weekly for 30 minutes during chemotherapy for the first 12 weeks incase of breast cancer. Last Dose 6mg/kg for 3 weeks. |
| Contraindication | None |
| Side Effects | Cardiomyopathy, Infusion reactions, Embryo-fetal Toxicity, Pulmonary toxicity,Exacerbation of chemotherapy-induced neutropenia, ever, nausea, vomiting, infusion reactions, diarrhea, infections, increased cough, headache, fatigue, dyspnea, rash, neutropenia, anemia, and myalgia. |
| Useful Link | http://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=492dbdb2-077e-4064-bff3-372d6af0a7a2 http://www.rxlist.com/herceptin-drug.htm |
| PubMed ID | 21813259, 14613027, 14528282, 12908564, 25572781, 25547504, 25532690, 25494663 |
| 3-D Structure | Th1061 (View) or (Download) |
| Entry 2 | |
| (2) Primary information | |
|---|---|
| ID | 1386 |
| ThPP ID | Th1061 |
| Therapeutic Peptide/Protein Name | Trastuzumab |
| Sequence | Light chain 1: DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAW view full sequnce in fasta |
| Functional Classification | IIa |
| Molecular Weight | 145531.5 |
| Chemical Formula | C6470H10012N1726O2013S42 |
| Isoelectric Point | 8.45 |
| Hydrophobicity | -0.415 |
| Melting Point (℃) | 62 (FAB f |
| Half Life | average 28.5 days |
| Description | A recombinant IgG1 kappa, humanized monoclonal antibody that selectively binds with high affinity in a cell-based assay (Kd = 5 nM) to the extracellular domain of the human epidermal growth factor receptor protein. Produced in CHO cell culture. |
| Indication/Disease | For treatment of early stage HER2-positive breast cancer, or metastatic breast cancer that substantially overexpress HER2. |
| Pharmacodynamics | Used in the treatment of HER2-positive breast cancer. HER2 protein overexpression is observed in 25%-30% of primary breast cancers.Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumorcells that overexpress HER2. It is a mediator of antibody dependent cellular cytotoxicity, in that the binding of the antibody to HER2 overexpressing cells leads to preferential cell death. |
| Mechanism of Action | Trastuzumab binds to the HER2 (or c-erbB2) proto-oncogene, an EGF receptor-like protein found on 20-30% of breast cancer cells. The binding leads to antibody mediated (complement mediated) killing of the HER2 positive cells. |
| Toxicity | Administration of trastuzumab can result in ventricular dysfunction and congestive heart failure. Risk of cardiotocity is especially elevated in patients recieving concurrent anthracycline or cyclophosphamide therapy. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | 45 mL/kg |
| Clearance | N.A. |
| Categories | Antineoplastic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Daunorubicin, Doxorubicin, Epirubicin), Idarubicin, Valrubicin. may increase the cardiotoxicity of drugs with trastuzumab. Signs and symptoms of cardiac dysfunction should be monitored for frequently. Increased risk of heart failure. Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 21813259, 14613027, 14528282, 12908564, 25572781, 25547504, 25532690, 25494663 |
| 3-D Structure | Th1061 (View) or (Download) |
| Entry 3 | |
| (3) Primary information | |
|---|---|
| ID | 1387 |
| ThPP ID | Th1061 |
| Therapeutic Peptide/Protein Name | Trastuzumab |
| Sequence | Light chain 1: DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAW view full sequnce in fasta |
| Functional Classification | IIa |
| Molecular Weight | 145531.5 |
| Chemical Formula | C6470H10012N1726O2013S42 |
| Isoelectric Point | 8.45 |
| Hydrophobicity | -0.415 |
| Melting Point (℃) | 63 (FAB f |
| Half Life | average 28.5 days |
| Description | A recombinant IgG1 kappa, humanized monoclonal antibody that selectively binds with high affinity in a cell-based assay (Kd = 5 nM) to the extracellular domain of the human epidermal growth factor receptor protein. Produced in CHO cell culture. |
| Indication/Disease | For treatment of early stage HER2-positive breast cancer, or metastatic breast cancer that substantially overexpress HER2. |
| Pharmacodynamics | Used in the treatment of HER2-positive breast cancer. HER2 protein overexpression is observed in 25%-30% of primary breast cancers.Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumorcells that overexpress HER2. It is a mediator of antibody dependent cellular cytotoxicity, in that the binding of the antibody to HER2 overexpressing cells leads to preferential cell death. |
| Mechanism of Action | Trastuzumab binds to the HER2 (or c-erbB2) proto-oncogene, an EGF receptor-like protein found on 20-30% of breast cancer cells. The binding leads to antibody mediated (complement mediated) killing of the HER2 positive cells. |
| Toxicity | Administration of trastuzumab can result in ventricular dysfunction and congestive heart failure. Risk of cardiotocity is especially elevated in patients recieving concurrent anthracycline or cyclophosphamide therapy. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | 46 mL/kg |
| Clearance | N.A. |
| Categories | Antineoplastic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Paclitaxel may increase the risk of neutropenia and anemia with trastuzumab. Concomitant therapy may also increase Trastuzumab serum concentration and decrease Paclitaxel serum concentrations. Monitor closely for adverse events and therapeutic response |
| Target | Insulin receptor,Insulin-like growth factor 1 receptor,Insulin-degrading enzyme,HLA class II histocompatibility antigen, DQ alpha 2 chain,HLA class II histocompatibility antigen, DQ beta 1 chain,Retinoblastoma-associated protein,Cathepsin D,Carboxypeptidase E,Neuroendocrine convertase 2,Neuroendocrine convertase 1,Protein NOV homolog,Low-density lipoprotein receptor-related protein 2,Insulin-like growth factor-binding protein 7,Synaptotagmin-like protein 4 |
| Information of corresponding available drug in the market | |
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 21813259, 14613027, 14528282, 12908564, 25572781, 25547504, 25532690, 25494663 |
| 3-D Structure | Th1061 (View) or (Download) |
| Entry 4 | |
| (4) Primary information | |
|---|---|
| ID | 1388 |
| ThPP ID | Th1061 |
| Therapeutic Peptide/Protein Name | Trastuzumab |
| Sequence | Light chain 1: DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAW view full sequnce in fasta |
| Functional Classification | IIa |
| Molecular Weight | 145531.5 |
| Chemical Formula | C6470H10012N1726O2013S42 |
| Isoelectric Point | 8.45 |
| Hydrophobicity | -0.415 |
| Melting Point (℃) | 64 (FAB f |
| Half Life | average 28.5 days |
| Description | A recombinant IgG1 kappa, humanized monoclonal antibody that selectively binds with high affinity in a cell-based assay (Kd = 5 nM) to the extracellular domain of the human epidermal growth factor receptor protein. Produced in CHO cell culture. |
| Indication/Disease | For treatment of early stage HER2-positive breast cancer, or metastatic breast cancer that substantially overexpress HER2. |
| Pharmacodynamics | Used in the treatment of HER2-positive breast cancer. HER2 protein overexpression is observed in 25%-30% of primary breast cancers.Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumorcells that overexpress HER2. It is a mediator of antibody dependent cellular cytotoxicity, in that the binding of the antibody to HER2 overexpressing cells leads to preferential cell death. |
| Mechanism of Action | Trastuzumab binds to the HER2 (or c-erbB2) proto-oncogene, an EGF receptor-like protein found on 20-30% of breast cancer cells. The binding leads to antibody mediated (complement mediated) killing of the HER2 positive cells. |
| Toxicity | Administration of trastuzumab can result in ventricular dysfunction and congestive heart failure. Risk of cardiotocity is especially elevated in patients recieving concurrent anthracycline or cyclophosphamide therapy. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | 47 mL/kg |
| Clearance | N.A. |
| Categories | Antineoplastic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Abatacept, Adalimumab, Alemtuzumab, Altretamine, Amsacrine, Anakinra, Asparaginase, Azacitidine, Azathioprine, Basiliximab, Betamethasone, Bleomycin, Busulfan, Capecitabine, Carboplatin, Carmustine, Chlorambucil, Cisplatin, Cladribine, Clofarabine, Corticotropin, Cortisone acetate, Cyclophosphamide, Cyclosporine, Cytarabine, Dacarbazine, Daclizumab, Dactinomycin, Denileukin diftitox, Dexamethasone, Docetaxel, Efalizumab, Erlotinib, Estramustine, Etanercept, Etoposide, Floxuridine, Fludarabine, Fludrocortisone, Fluorouracil, Gefitinib, Gemcitabine, Hydrocortisone, Hydroxyurea, Ibritumomab, Ifosfamide, Imatinib, Infliximab, Irinotecan, Lenalidomide, Lomustine, Mechlorethamine, Melphalan, Mercaptopurine, Methotrexate, Methylprednisolone, Mitomycin, Mitoxantrone, Muromonab, Mycophenolate mofetil, Mycophenolic acid, Natalizumab, Nelarabine, Nilotinib, Oxaliplatin, Pegaspargase, Pentostatin, Prednisolone, Prednisone, Procarbazine, Rilonacept, Rituximab, Sirolimus, Sorafenib, Streptozocin, Sunitinib, Tacrolimus, Temozolomide, Temsirolimus, Teniposide, Thalidomide, Thiotepa, Tioguanine, Tofacitinib, Topotecan, Tositumomab, Tretinoin, Triamcinolone, Vinblastine, Vincristine, Vinorelbine may increase the risk of neutropenia and anemia with trastuzumab. Monitor closely for signs and symptoms of adverse events. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 21813259, 14613027, 14528282, 12908564, 25572781, 25547504, 25532690, 25494663 |
| 3-D Structure | Th1061 (View) or (Download) |