| Entry 1 |
| (1) Primary information |
|---|
| ID | 1428 |
| ThPP ID | Th1072 |
| Therapeutic Peptide/Protein Name | Streptokinase |
| Sequence | MKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLVVSVAG view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 47286.7 |
| Chemical Formula | C2100H3278N566O669S4 |
| Isoelectric Point | 5.12 |
| Hydrophobicity | -0.728 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Streptokinase, is a sterile, purified preparation of a bacterial protein elaborated by group C (beta) -hemolytic streptococci. |
| Indication/Disease | For the treatment of acute evolving transmural myocardial infarction, pulmonary embolism, deep vein thrombosis, arterial thrombosis or emolism and occlusion of arteriovenous cannulae |
| Pharmacodynamics | Streptokinase creates an active complex which promotes the cleavage of the Arg/Val bond in plasminogen to form the proteolytic enzyme plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction. |
| Mechanism of Action | Plasminogen is an inactive molecule that becomes activated to plasmin when the Arg/Val bond is cleaved. Plasmin breaks down fibrin clots created by the blood clotting cascade. Streptokinase forms a highly specific 1:1 enzymatic complex with plasminogen which converts inactive plasminogen molecules into active plasmin. Plasmin degrades fibrin clots as well as fibrinogen and other plasma proteins. This in turn leads to the degradation of blood clots. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Fibrinolytic Agents and Thrombolytic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | Ticlopidine Increases bleeding risk. Monitor for signs of bleeding |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | Streptase |
| Company | CSL Behring |
| Brand Discription | Streptase (Streptokinase)a bacterial protein elaborated by group CÂ (beta)Â -hemolytic streptococci. |
| Prescribed for | Indicated in Acute Evolving Transmural Myocardial Infarction, Pulmonary Embolism, Deep Vein Thrombosis, Arterial Thrombosis or Embolism, Occlusion of Arteriovenous Cannulae |
| Chemical Name | N.A. |
| Formulation | 25 mg cross-linked gelatin polypeptides, 25 mg sodium L-glutamate, sodium hydroxide to adjust pH, and 100 mg Albumin (Human) per vial or infusion bottle as stabilizers. The preparation contains no preservatives |
| Physcial Appearance | It is Sterile, purified preparation formulated as lypholized powder |
| Route of Administration | Intravenous and intracoronary administration. |
| Recommended Dosage | In Acute Evolving Transmural Myocardial Infarction,dose for IV-In 1,500,000 IU and IC-In 140,000 IU. For Pulmonary Embolism, Deep Vein Thrombosis, Arterial Thrombosis or Embolism, IV-In: 250,000 IU/30 min |
| Contraindication | No Information Provided. |
| Side Effects | Severe internal bleeding involving gastrointestinal  (including hepaticbleeding), genitourinary, retroperitoneal, or intracerebral sites has occurred and has resulted in fatalities. Minor breathing difficulty to bronchospasm, periorbital swelling or angioneurotic edema have been observed rarely. Other milder allergic effects such as urticaria, itching, flushing, nausea, headache and musculoskeletal pain have also been observed, as have delayed hypersensitivity reactions such as vasculitis and interstitial nephritis, Respiratory depression, etc. |
| Useful Link | http://www.rxlist.com/streptase-drug.htm |
| PubMed ID | 27192220, 26876783, 11442014, 8053983, 12428432, 1439452, 3488869, 28297015, 28292359 |
| 3-D Structure | Th1072 (View) or (Download) |
| Entry 2 |
| (2) Primary information |
|---|
| ID | 1429 |
| ThPP ID | Th1072 |
| Therapeutic Peptide/Protein Name | Streptokinase |
| Sequence | MKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLVVSVAG view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 47286.7 |
| Chemical Formula | C2100H3278N566O669S4 |
| Isoelectric Point | 5.12 |
| Hydrophobicity | -0.728 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Streptokinase, is a sterile, purified preparation of a bacterial protein elaborated by group C (beta) -hemolytic streptococci. |
| Indication/Disease | For the treatment of acute evolving transmural myocardial infarction, pulmonary embolism, deep vein thrombosis, arterial thrombosis or emolism and occlusion of arteriovenous cannulae |
| Pharmacodynamics | Streptokinase creates an active complex which promotes the cleavage of the Arg/Val bond in plasminogen to form the proteolytic enzyme plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction. |
| Mechanism of Action | Plasminogen is an inactive molecule that becomes activated to plasmin when the Arg/Val bond is cleaved. Plasmin breaks down fibrin clots created by the blood clotting cascade. Streptokinase forms a highly specific 1:1 enzymatic complex with plasminogen which converts inactive plasminogen molecules into active plasmin. Plasmin degrades fibrin clots as well as fibrinogen and other plasma proteins. This in turn leads to the degradation of blood clots. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Fibrinolytic Agents and Thrombolytic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 27192220, 26876783, 11442014, 8053983, 12428432, 1439452, 3488869, 28297015, 28292359 |
| 3-D Structure | Th1072 (View) or (Download) |
| Entry 3 |
| (3) Primary information |
|---|
| ID | 1430 |
| ThPP ID | Th1072 |
| Therapeutic Peptide/Protein Name | Streptokinase |
| Sequence | MKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLVVSVAG view full sequnce in fasta |
| Functional Classification | Ic |
| Molecular Weight | 47286.7 |
| Chemical Formula | C2100H3278N566O669S4 |
| Isoelectric Point | 5.12 |
| Hydrophobicity | -0.728 |
| Melting Point (℃) | N.A. |
| Half Life | N.A. |
| Description | Streptokinase, is a sterile, purified preparation of a bacterial protein elaborated by group C (beta) -hemolytic streptococci. |
| Indication/Disease | For the treatment of acute evolving transmural myocardial infarction, pulmonary embolism, deep vein thrombosis, arterial thrombosis or emolism and occlusion of arteriovenous cannulae |
| Pharmacodynamics | Streptokinase creates an active complex which promotes the cleavage of the Arg/Val bond in plasminogen to form the proteolytic enzyme plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction. |
| Mechanism of Action | Plasminogen is an inactive molecule that becomes activated to plasmin when the Arg/Val bond is cleaved. Plasmin breaks down fibrin clots created by the blood clotting cascade. Streptokinase forms a highly specific 1:1 enzymatic complex with plasminogen which converts inactive plasminogen molecules into active plasmin. Plasmin degrades fibrin clots as well as fibrinogen and other plasma proteins. This in turn leads to the degradation of blood clots. |
| Toxicity | N.A. |
| Metabolism | N.A. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Fibrinolytic Agents and Thrombolytic Agents |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market |
|---|
| Brand Name | N.A. |
| Company | N.A. |
| Brand Discription | N.A. |
| Prescribed for | N.A. |
| Chemical Name | N.A. |
| Formulation | N.A. |
| Physcial Appearance | N.A. |
| Route of Administration | N.A. |
| Recommended Dosage | N.A. |
| Contraindication | N.A. |
| Side Effects | N.A. |
| Useful Link | N.A. |
| PubMed ID | 27192220, 26876783, 11442014, 8053983, 12428432, 1439452, 3488869, 28297015, 28292359 |
| 3-D Structure | Th1072 (View) or (Download) |