A database of FDA approved therapeutic peptides and proteins
Details of Th1073 which contains 2 entries. |
| Entry 1 | |
| (1) Primary information | |
|---|---|
| ID | 1431 |
| ThPP ID | Th1073 |
| Therapeutic Peptide/Protein Name | Alemtuzumab |
| Sequence | Heavy Chain 1: QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMN view full sequnce in fasta |
| Functional Classification | IIa |
| Molecular Weight | 145453.8 |
| Chemical Formula | C6468H10066N1732O2005S40 |
| Isoelectric Point | 8.76 |
| Hydrophobicity | -0.431 |
| Melting Point (℃) | 61 (FAB f |
| Half Life | 288 hrs |
| Description | Humanized monoclonal antibody specific to lymphocyte antigens. It is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) that is directed against the 21-28 kD cell surface glycoprotein,CD52. The Campath-1H antibody is an IgG1 kappa with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). Campath is produced in mammalian cell (Chinese hamster ovary) suspension culture in a medium containing neomycin. |
| Indication/Disease | Alemtuzumab (Campath) is a monoclonal antibody therapy used for treatment of B-cell chronic lymphocytic leukemia. |
| Pharmacodynamics | Campath is used to treat leukemia by exploiting antibody mediated lysis of CD52 presenting cells. The CD52 antigen is a cell surface protein found on essentially all B and T lymphocytes, a majority of monocytes, macrophages and most granulocytes. The CD52 antigen is not present on erythrocytes or hematopoetic stem cells. In leukemia there is an excess of B and T cells, so Campath permits selective reduction of lymphocyte populations. |
| Mechanism of Action | Campath binds to the CD52 antigen present on most B and T lymphocytes. This binding leads to antibody-dependent lysis of leukemic cells. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system when bound to B or T lymphocytes |
| Absorption | N.A. |
| Volume of Distribution | 0.18 L/kg |
| Clearance | N.A. |
| Categories | N.A. |
| Patents Number | CA1339198 |
| Date of Issue | 06/08/01 |
| Date of Expiry | 06/08/18 |
| Drug Interaction | Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | CAMPATH |
| Company | Genzyme Corporation |
| Brand Discription | Campath (alemtuzumab) is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) directed against the 21-28 kD cell surface glycoprotein, CD52. Campath-1H is an IgG1 kappa antibody with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). The Campath-1H antibody has an approximate molecular weight of 150 kD. Campath is produced in mammalian cell (Chinese hamster ovary)Â |
| Prescribed for | Campath is a CD52-directed cytolytic antibody indicated as a single agent for the treatment of B-cell chronic lymphocytic leukemia (B-CLL) |
| Chemical Name | N.A. |
| Formulation | Each single use vial of Campath contains 30 mg alemtuzumab, 8.0 mg sodium chloride, 1.44 mg dibasic sodium phosphate, 0.2 mg potassium chloride, 0.2 mg monobasic potassium phosphate, 0.1 mg polysorbate 80, and 0.0187 mg disodium edetate dihydrate. No preservatives are added. |
| Physcial Appearance | Campath is a sterile, clear, colorless, isotonic solution (pH 6.8-7.4) for injection. |
| Route of Administration | Intravenous infusion |
| Recommended Dosage | Administer as an IV infusion over 2 hours, Escalate to recommended dose of 30 mg/day three times per week for 12 weeks, Premedicate with oral antihistamine and acetaminophen prior to dosing |
| Contraindication | None |
| Side Effects | Most common adverse reactions (>=10%): cytopenias, infusion reactions, cytomegalovirus (CMV) and other infections, nausea, emesis, diarrhea, and insomnia. |
| Useful Link | http://www.rxlist.com/campath-drug.htm |
| PubMed ID | 27645339, 26384035, 26253589, 25887773, 25846320, 24090587, 19967103, 16810345, 16179960, 18588450, 12130484, 17051245, 9593475 |
| 3-D Structure | Th1073 (View) or (Download) |
| Entry 2 | |
| (2) Primary information | |
|---|---|
| ID | 1432 |
| ThPP ID | Th1073 |
| Therapeutic Peptide/Protein Name | Alemtuzumab |
| Sequence | Heavy Chain 1: QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMN view full sequnce in fasta |
| Functional Classification | IIa |
| Molecular Weight | 145453.8 |
| Chemical Formula | C6468H10066N1732O2005S40 |
| Isoelectric Point | 8.76 |
| Hydrophobicity | -0.431 |
| Melting Point (℃) | 62 (FAB f |
| Half Life | 289 hrs |
| Description | Humanized monoclonal antibody specific to lymphocyte antigens. It is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) that is directed against the 21-28 kD cell surface glycoprotein,CD52. The Campath-1H antibody is an IgG1 kappa with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). Campath is produced in mammalian cell (Chinese hamster ovary) suspension culture in a medium containing neomycin. |
| Indication/Disease | Alemtuzumab (Campath) is a monoclonal antibody therapy used for treatment of B-cell chronic lymphocytic leukemia. |
| Pharmacodynamics | Campath is used to treat leukemia by exploiting antibody mediated lysis of CD52 presenting cells. The CD52 antigen is a cell surface protein found on essentially all B and T lymphocytes, a majority of monocytes, macrophages and most granulocytes. The CD52 antigen is not present on erythrocytes or hematopoetic stem cells. In leukemia there is an excess of B and T cells, so Campath permits selective reduction of lymphocyte populations. |
| Mechanism of Action | Campath binds to the CD52 antigen present on most B and T lymphocytes. This binding leads to antibody-dependent lysis of leukemic cells. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system when bound to B or T lymphocytes |
| Absorption | N.A. |
| Volume of Distribution | 0.18 L/kg |
| Clearance | N.A. |
| Categories | N.A. |
| Patents Number | N.A. |
| Date of Issue | N.A. |
| Date of Expiry | N.A. |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | LEMTRADA |
| Company | Sanofi Genzyme, a Division of Sanofi Aventis Canada Inc |
| Brand Discription | LEMTRADA (alemtuzumab) is a recombinant humanized IgG1 kappa monoclonal antibody directed against the cell surface glycoprotein, CD52. Alemtuzumab has an approximate molecular weight of 150kD. LEMTRADA is produced in mammalian cell (Chinese hamster ovary) suspension culture in a nutrient medium containing neomycin. Neomycin is not detectable in the final product. |
| Prescribed for | LEMTRADA is a CD52-directed cytolytic monoclonal antibody indicated for the treatment of patients with relapsing forms of multiple sclerosis (MS). Because of its safety profile, the use of LEMTRADA should generally be reserved for patients who have had an inadequate response to two or more drugs indicated for the treatment of MS. |
| Chemical Name | N.A. |
| Formulation | Each 1 mL of solution contains alemtuzumab 10 mg, dibasic sodium phosphate (1.15 mg), disodium edetate dihydrate (0.0187 mg), polysorbate 80 (0.1 mg), potassium chloride (0.2 mg), potassium dihydrogen phosphate (0.2 mg), sodium chloride (8 mg), and water for injection. |
| Physcial Appearance | LEMTRADA is a sterile, clear and colorless to slightly yellow, solution (pH 7.2±0.2) for infusion. |
| Route of Administration | Intravenous infusion |
| Recommended Dosage | Administer LEMTRADA by Intravenous infusion over 4 hours for 2 treatment courses. First course: 12 mg/day on 5 consecutive days. Second course: 12 mg/day on 3 consecutive days 12 months after first treatment course. |
| Contraindication | LEMTRADA is contraindicated in patients who are infected with Human Immunodeficiency Virus (HIV) because LEMTRADA causes prolonged reductions of CD4+ lymphocyte counts. |
| Side Effects | Most common adverse reactions (incidence >= 10% and > interferon beta-1a): rash, headache, pyrexia, nasopharyngitis, nausea, urinary tract infection, fatigue, insomnia, upper respiratory tract infection, herpes viral infection, urticaria, pruritus, thyroid gland disorders, fungal infection, arthralgia, pain in extremity, back pain, diarrhea, sinusitis, oropharyngeal pain, paresthesia, dizziness, abdominal pain, flushing, and vomiting. |
| Useful Link | http://www.rxlist.com/lemtrada-drug.htm |
| PubMed ID | 27645339, 26384035, 26253589, 25887773, 25846320, 24090587, 19967103, 16810345, 16179960, 26204829, 25584072 |
| 3-D Structure | Th1073 (View) or (Download) |