Detailed description page of THPdb

Details of Th1073 which contains 2 entries.

Entry 1
(1) Primary information
ID 1431
ThPP ID Th1073
Therapeutic Peptide/Protein Name Alemtuzumab
Sequence Heavy Chain 1: QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMN view full sequnce in fasta
Functional Classification IIa
Molecular Weight 145453.8
Chemical Formula C6468H10066N1732O2005S40
Isoelectric Point 8.76
Hydrophobicity -0.431
Melting Point (℃) 61 (FAB f
Half Life 288 hrs
Description Humanized monoclonal antibody specific to lymphocyte antigens. It is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) that is directed against the 21-28 kD cell surface glycoprotein,CD52. The Campath-1H antibody is an IgG1 kappa with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). Campath is produced in mammalian cell (Chinese hamster ovary) suspension culture in a medium containing neomycin.
Indication/Disease Alemtuzumab (Campath) is a monoclonal antibody therapy used for treatment of B-cell chronic lymphocytic leukemia.
Pharmacodynamics Campath is used to treat leukemia by exploiting antibody mediated lysis of CD52 presenting cells. The CD52 antigen is a cell surface protein found on essentially all B and T lymphocytes, a majority of monocytes, macrophages and most granulocytes. The CD52 antigen is not present on erythrocytes or hematopoetic stem cells. In leukemia there is an excess of B and T cells, so Campath permits selective reduction of lymphocyte populations.
Mechanism of Action Campath binds to the CD52 antigen present on most B and T lymphocytes. This binding leads to antibody-dependent lysis of leukemic cells.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system when bound to B or T lymphocytes
Absorption N.A.
Volume of Distribution 0.18 L/kg
Clearance N.A.
Categories N.A.
Patents Number CA1339198
Date of Issue 06/08/01
Date of Expiry 06/08/18
Drug Interaction Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target N.A.
Information of corresponding available drug in the market
Brand Name CAMPATH
Company Genzyme Corporation
Brand Discription Campath (alemtuzumab) is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) directed against the 21-28 kD cell surface glycoprotein, CD52. Campath-1H is an IgG1 kappa antibody with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). The Campath-1H antibody has an approximate molecular weight of 150 kD. Campath is produced in mammalian cell (Chinese hamster ovary)Â
Prescribed for Campath is a CD52-directed cytolytic antibody indicated as a single agent for the treatment of B-cell chronic lymphocytic leukemia (B-CLL)
Chemical Name N.A.
Formulation Each single use vial of Campath contains 30 mg alemtuzumab, 8.0 mg sodium chloride, 1.44 mg dibasic sodium phosphate, 0.2 mg potassium chloride, 0.2 mg monobasic potassium phosphate, 0.1 mg polysorbate 80, and 0.0187 mg disodium edetate dihydrate. No preservatives are added.
Physcial Appearance Campath is a sterile, clear, colorless, isotonic solution (pH 6.8-7.4) for injection.
Route of Administration Intravenous infusion
Recommended Dosage Administer as an IV infusion over 2 hours, Escalate to recommended dose of 30 mg/day three times per week for 12 weeks, Premedicate with oral antihistamine and acetaminophen prior to dosing
Contraindication None
Side Effects Most common adverse reactions (>=10%): cytopenias, infusion reactions, cytomegalovirus (CMV) and other infections, nausea, emesis, diarrhea, and insomnia.
Useful Link http://www.rxlist.com/campath-drug.htm
PubMed ID 27645339, 26384035, 26253589, 25887773, 25846320, 24090587, 19967103, 16810345, 16179960, 18588450, 12130484, 17051245, 9593475
3-D Structure Th1073 (View) or (Download)

Entry 2
(2) Primary information
ID 1432
ThPP ID Th1073
Therapeutic Peptide/Protein Name Alemtuzumab
Sequence Heavy Chain 1: QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMN view full sequnce in fasta
Functional Classification IIa
Molecular Weight 145453.8
Chemical Formula C6468H10066N1732O2005S40
Isoelectric Point 8.76
Hydrophobicity -0.431
Melting Point (℃) 62 (FAB f
Half Life 289 hrs
Description Humanized monoclonal antibody specific to lymphocyte antigens. It is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) that is directed against the 21-28 kD cell surface glycoprotein,CD52. The Campath-1H antibody is an IgG1 kappa with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). Campath is produced in mammalian cell (Chinese hamster ovary) suspension culture in a medium containing neomycin.
Indication/Disease Alemtuzumab (Campath) is a monoclonal antibody therapy used for treatment of B-cell chronic lymphocytic leukemia.
Pharmacodynamics Campath is used to treat leukemia by exploiting antibody mediated lysis of CD52 presenting cells. The CD52 antigen is a cell surface protein found on essentially all B and T lymphocytes, a majority of monocytes, macrophages and most granulocytes. The CD52 antigen is not present on erythrocytes or hematopoetic stem cells. In leukemia there is an excess of B and T cells, so Campath permits selective reduction of lymphocyte populations.
Mechanism of Action Campath binds to the CD52 antigen present on most B and T lymphocytes. This binding leads to antibody-dependent lysis of leukemic cells.
Toxicity N.A.
Metabolism Most likely removed by opsonization via the reticuloendothelial system when bound to B or T lymphocytes
Absorption N.A.
Volume of Distribution 0.18 L/kg
Clearance N.A.
Categories N.A.
Patents Number N.A.
Date of Issue N.A.
Date of Expiry N.A.
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name LEMTRADA
Company Sanofi Genzyme, a Division of Sanofi Aventis Canada Inc
Brand Discription LEMTRADA (alemtuzumab) is a recombinant humanized IgG1 kappa monoclonal antibody directed against the cell surface glycoprotein, CD52. Alemtuzumab has an approximate molecular weight of 150kD. LEMTRADA is produced in mammalian cell (Chinese hamster ovary) suspension culture in a nutrient medium containing neomycin. Neomycin is not detectable in the final product.
Prescribed for LEMTRADA is a CD52-directed cytolytic monoclonal antibody indicated for the treatment of patients with relapsing forms of multiple sclerosis (MS). Because of its safety profile, the use of LEMTRADA should generally be reserved for patients who have had an inadequate response to two or more drugs indicated for the treatment of MS.
Chemical Name N.A.
Formulation Each 1 mL of solution contains alemtuzumab 10 mg, dibasic sodium phosphate (1.15 mg), disodium edetate dihydrate (0.0187 mg), polysorbate 80 (0.1 mg), potassium chloride (0.2 mg), potassium dihydrogen phosphate (0.2 mg), sodium chloride (8 mg), and water for injection.
Physcial Appearance LEMTRADA is a sterile, clear and colorless to slightly yellow, solution (pH 7.2Â±0.2) for infusion.
Route of Administration Intravenous infusion
Recommended Dosage Administer LEMTRADA by Intravenous infusion over 4 hours for 2 treatment courses. First course: 12 mg/day on 5 consecutive days. Second course: 12 mg/day on 3 consecutive days 12 months after first treatment course.
Contraindication LEMTRADA is contraindicated in patients who are infected with Human Immunodeficiency Virus (HIV) because LEMTRADA causes prolonged reductions of CD4+ lymphocyte counts.
Side Effects Most common adverse reactions (incidence >= 10% and > interferon beta-1a): rash, headache, pyrexia, nasopharyngitis, nausea, urinary tract infection, fatigue, insomnia, upper respiratory tract infection, herpes viral infection, urticaria, pruritus, thyroid gland disorders, fungal infection, arthralgia, pain in extremity, back pain, diarrhea, sinusitis, oropharyngeal pain, paresthesia, dizziness, abdominal pain, flushing, and vomiting.
Useful Link http://www.rxlist.com/lemtrada-drug.htm
PubMed ID 27645339, 26384035, 26253589, 25887773, 25846320, 24090587, 19967103, 16810345, 16179960, 26204829, 25584072
3-D Structure Th1073 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1431
ThPP ID	Th1073
Therapeutic Peptide/Protein Name	Alemtuzumab
Sequence	Heavy Chain 1: QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMN view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	145453.8
Chemical Formula	C6468H10066N1732O2005S40
Isoelectric Point	8.76
Hydrophobicity	-0.431
Melting Point (℃)	61 (FAB f
Half Life	288 hrs
Description	Humanized monoclonal antibody specific to lymphocyte antigens. It is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) that is directed against the 21-28 kD cell surface glycoprotein,CD52. The Campath-1H antibody is an IgG1 kappa with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). Campath is produced in mammalian cell (Chinese hamster ovary) suspension culture in a medium containing neomycin.
Indication/Disease	Alemtuzumab (Campath) is a monoclonal antibody therapy used for treatment of B-cell chronic lymphocytic leukemia.
Pharmacodynamics	Campath is used to treat leukemia by exploiting antibody mediated lysis of CD52 presenting cells. The CD52 antigen is a cell surface protein found on essentially all B and T lymphocytes, a majority of monocytes, macrophages and most granulocytes. The CD52 antigen is not present on erythrocytes or hematopoetic stem cells. In leukemia there is an excess of B and T cells, so Campath permits selective reduction of lymphocyte populations.
Mechanism of Action	Campath binds to the CD52 antigen present on most B and T lymphocytes. This binding leads to antibody-dependent lysis of leukemic cells.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system when bound to B or T lymphocytes
Absorption	N.A.
Volume of Distribution	0.18 L/kg
Clearance	N.A.
Categories	N.A.
Patents Number	CA1339198
Date of Issue	06/08/01
Date of Expiry	06/08/18
Drug Interaction	Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	CAMPATH
Company	Genzyme Corporation
Brand Discription	Campath (alemtuzumab) is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) directed against the 21-28 kD cell surface glycoprotein, CD52. Campath-1H is an IgG1 kappa antibody with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). The Campath-1H antibody has an approximate molecular weight of 150 kD. Campath is produced in mammalian cell (Chinese hamster ovary)Â
Prescribed for	Campath is a CD52-directed cytolytic antibody indicated as a single agent for the treatment of B-cell chronic lymphocytic leukemia (B-CLL)
Chemical Name	N.A.
Formulation	Each single use vial of Campath contains 30 mg alemtuzumab, 8.0 mg sodium chloride, 1.44 mg dibasic sodium phosphate, 0.2 mg potassium chloride, 0.2 mg monobasic potassium phosphate, 0.1 mg polysorbate 80, and 0.0187 mg disodium edetate dihydrate. No preservatives are added.
Physcial Appearance	Campath is a sterile, clear, colorless, isotonic solution (pH 6.8-7.4) for injection.
Route of Administration	Intravenous infusion
Recommended Dosage	Administer as an IV infusion over 2 hours, Escalate to recommended dose of 30 mg/day three times per week for 12 weeks, Premedicate with oral antihistamine and acetaminophen prior to dosing
Contraindication	None
Side Effects	Most common adverse reactions (>=10%): cytopenias, infusion reactions, cytomegalovirus (CMV) and other infections, nausea, emesis, diarrhea, and insomnia.
Useful Link	http://www.rxlist.com/campath-drug.htm
PubMed ID	27645339, 26384035, 26253589, 25887773, 25846320, 24090587, 19967103, 16810345, 16179960, 18588450, 12130484, 17051245, 9593475
3-D Structure	Th1073 (View) or (Download)

(2) Primary information
Entry 2
ID	1432
ThPP ID	Th1073
Therapeutic Peptide/Protein Name	Alemtuzumab
Sequence	Heavy Chain 1: QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMN view full sequnce in fasta
Functional Classification	IIa
Molecular Weight	145453.8
Chemical Formula	C6468H10066N1732O2005S40
Isoelectric Point	8.76
Hydrophobicity	-0.431
Melting Point (℃)	62 (FAB f
Half Life	289 hrs
Description	Humanized monoclonal antibody specific to lymphocyte antigens. It is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) that is directed against the 21-28 kD cell surface glycoprotein,CD52. The Campath-1H antibody is an IgG1 kappa with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). Campath is produced in mammalian cell (Chinese hamster ovary) suspension culture in a medium containing neomycin.
Indication/Disease	Alemtuzumab (Campath) is a monoclonal antibody therapy used for treatment of B-cell chronic lymphocytic leukemia.
Pharmacodynamics	Campath is used to treat leukemia by exploiting antibody mediated lysis of CD52 presenting cells. The CD52 antigen is a cell surface protein found on essentially all B and T lymphocytes, a majority of monocytes, macrophages and most granulocytes. The CD52 antigen is not present on erythrocytes or hematopoetic stem cells. In leukemia there is an excess of B and T cells, so Campath permits selective reduction of lymphocyte populations.
Mechanism of Action	Campath binds to the CD52 antigen present on most B and T lymphocytes. This binding leads to antibody-dependent lysis of leukemic cells.
Toxicity	N.A.
Metabolism	Most likely removed by opsonization via the reticuloendothelial system when bound to B or T lymphocytes
Absorption	N.A.
Volume of Distribution	0.18 L/kg
Clearance	N.A.
Categories	N.A.
Patents Number	N.A.
Date of Issue	N.A.
Date of Expiry	N.A.
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	LEMTRADA
Company	Sanofi Genzyme, a Division of Sanofi Aventis Canada Inc
Brand Discription	LEMTRADA (alemtuzumab) is a recombinant humanized IgG1 kappa monoclonal antibody directed against the cell surface glycoprotein, CD52. Alemtuzumab has an approximate molecular weight of 150kD. LEMTRADA is produced in mammalian cell (Chinese hamster ovary) suspension culture in a nutrient medium containing neomycin. Neomycin is not detectable in the final product.
Prescribed for	LEMTRADA is a CD52-directed cytolytic monoclonal antibody indicated for the treatment of patients with relapsing forms of multiple sclerosis (MS). Because of its safety profile, the use of LEMTRADA should generally be reserved for patients who have had an inadequate response to two or more drugs indicated for the treatment of MS.
Chemical Name	N.A.
Formulation	Each 1 mL of solution contains alemtuzumab 10 mg, dibasic sodium phosphate (1.15 mg), disodium edetate dihydrate (0.0187 mg), polysorbate 80 (0.1 mg), potassium chloride (0.2 mg), potassium dihydrogen phosphate (0.2 mg), sodium chloride (8 mg), and water for injection.
Physcial Appearance	LEMTRADA is a sterile, clear and colorless to slightly yellow, solution (pH 7.2Â±0.2) for infusion.
Route of Administration	Intravenous infusion
Recommended Dosage	Administer LEMTRADA by Intravenous infusion over 4 hours for 2 treatment courses. First course: 12 mg/day on 5 consecutive days. Second course: 12 mg/day on 3 consecutive days 12 months after first treatment course.
Contraindication	LEMTRADA is contraindicated in patients who are infected with Human Immunodeficiency Virus (HIV) because LEMTRADA causes prolonged reductions of CD4+ lymphocyte counts.
Side Effects	Most common adverse reactions (incidence >= 10% and > interferon beta-1a): rash, headache, pyrexia, nasopharyngitis, nausea, urinary tract infection, fatigue, insomnia, upper respiratory tract infection, herpes viral infection, urticaria, pruritus, thyroid gland disorders, fungal infection, arthralgia, pain in extremity, back pain, diarrhea, sinusitis, oropharyngeal pain, paresthesia, dizziness, abdominal pain, flushing, and vomiting.
Useful Link	http://www.rxlist.com/lemtrada-drug.htm
PubMed ID	27645339, 26384035, 26253589, 25887773, 25846320, 24090587, 19967103, 16810345, 16179960, 26204829, 25584072
3-D Structure	Th1073 (View) or (Download)