A database of FDA approved therapeutic peptides and proteins
Details of Th1089 which contains 1 entries. |
| Entry 1 | |
| (1) Primary information | |
|---|---|
| ID | 1465 |
| ThPP ID | Th1089 |
| Therapeutic Peptide/Protein Name | Palivizumab |
| Sequence | VH region: QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGW view full sequnce in fasta |
| Functional Classification | IIIa |
| Molecular Weight | N.A. |
| Chemical Formula | N.A. |
| Isoelectric Point | N.A. |
| Hydrophobicity | N.A. |
| Melting Point (℃) | 61 (FAB fr |
| Half Life | 18-20 days (in adults) |
| Description | Humanized, recombinant, monoclonal antibody (IgG1k) directed agaisnt the epitope in the A antigenic site of the F protein of respiratory syncytial virus (RSV). Synagis is a composite of human (95%) and murine (5%) antibody sequences. The human heavy chain sequence is derived from the constant domains of human IgG1 and the variable framework regions of the VH genes Cor (1) and Cess (2). The human light chain sequence is derived from the constant domain of Ck and the variable framework regions of the VL gene K104 withJk-4. Palivizumab is expressed from a stable murine myeloma cell line (NS0). Palivizumab is composed of to heavy chains (50.6 kDa each) and two light chains (27.6 kDa each), contains 1-2% carbohydrate by weight and has a molecular weight of 147.7 kDa ± 1 kDa (MALDI-TOF). |
| Indication/Disease | For prophylaxis of respiratory diseases casued by respiratory syncytial virus. |
| Pharmacodynamics | Synagis exhibits neutralizing and fusion-inhibitory activity against Respiratory syncytial virus (RSV). These activities inhibit RSV replication or spread. Synagis is given to prevent the development of lower respiratory tract disease in pediatric patients. |
| Mechanism of Action | Palivizumab binds to the fusion glycoprotein of RSV. This prevents its binding and uptake by host cellular receptors. |
| Toxicity | N.A. |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | N.A. |
| Volume of Distribution | N.A. |
| Clearance | N.A. |
| Categories | Antiviral Agents |
| Patents Number | CA2197684 |
| Date of Issue | 01/11/04 |
| Date of Expiry | 10/08/19 |
| Drug Interaction | N.A. |
| Target | N.A. |
| Information of corresponding available drug in the market | |
| Brand Name | Synagis |
| Company | MedImmune |
| Brand Discription | Palivizumab is a humanized monoclonal antibody (IgG1κ) produced by recombinant DNA technology, directed to an epitope in the A antigenic site of the F protein of RSV. Palivizumab is a composite of human (95%) and murine (5%) antibody sequences. The human heavy chain sequence was derived from the constant domains of human IgG1 and the variable framework regions of the VH genes Cor and Cess. The human light chain sequence was derived from the constant domain of Cκ and the variable framework regions of the VL gene K104 with Jκ -4. The murine sequences were derived from a murine monoclonal antibody, Mab 1129, in a process that involved the grafting of the murine complementarity determining regions into the human antibody frameworks. Palivizumab is composed of two heavy chains and two light chains and has a molecular weight of approximately 148,000 Daltons. |
| Prescribed for | Palivizumab inhibits the actions of respiratory syncytial virus (RSV) and helps to prevent the disease |
| Chemical Name | N.A. |
| Formulation | 100 mg single-dose vial of Synagis liquid solution contains 100 mg of palivizumab and also contains chloride (0.5 mg), glycine (0.1 mg), and histidine (3.9 mg), in a volume of 1 mL. |
| Physcial Appearance | Sterile, preservative-free liquid solution |
| Route of Administration | Intramuscular |
| Recommended Dosage | recommended dose of Synagis is 15 mg per kg of body weight given monthly by intramuscular injection. The first dose of Synagis should be administered prior to commencement of the RSV season and the remaining doses should be administered monthly throughout the RSV season. Children who develop an RSV infection should continue to receive monthly doses throughout the RSV season. In the northern hemisphere, the RSV season typically commences in November and lasts through April, but it may begin earlier or persist later in certain communities. |
| Contraindication | indicated for the prevention of serious lower respiratory tract disease caused by respiratory syncytial virus (RSV) in children at high risk of RSV disease.The following points should be considered when prescribing Synagis: Safety and efficacy were established in children with bronchopulmonary dysplasia (BPD), infants with a history of premature birth (less than or equal to 35 weeks gestational age), and children with hemodynamically significant congenital heart disease (CHD). |
| Side Effects | high fever, ear pain or drainage, tugging at the ear; warmth or swelling of the ear; crying or fussiness, especially while lying down; change in sleeping patterns; poor feeding or loss of appetite; easy bruising or bleeding; or trouble breathing. |
| Useful Link | http://www.rxlist.com/synagis-drug/indications-dosage.htm http://www.drugs.com/synagis.html |
| PubMed ID | 25565893, 25563005, 25551881, 25548575, 25483663 |
| 3-D Structure | Th1089 (View) or (Download) |