Detailed description page of THPdb

Details of Th1121 which contains 2 entries.

Entry 1
(1) Primary information
ID 1560
ThPP ID Th1121
Therapeutic Peptide/Protein Name Pertuzumab
Sequence light chain DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQ view full sequnce in fasta
Functional Classification IIIc
Molecular Weight 148000
Chemical Formula N.A.
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life 18 days
Description Recombinant, humanized monoclonal antibody that targets the extracellular dimerization domain (Subdomain II) of the human epidermal growth factor receptor 2 protein (HER2). Two heavy chains and two lights chains are composed of 448 and 214 residues respectively. FDA approved June 8, 2012.
Indication/Disease Pertuzumab is indicated for use in combination with trastuzumab and docetaxel for the treatment of patients with HER2-positive metastatic breast cancer who have not received prior anti-HER2 therapy or chemotherapy for metastatic disease.
Pharmacodynamics N.A.
Mechanism of Action Pertuzumab is a humanized monoclonal antibody designed to bind to the HER2 receptor and inhibit the ability of HER2 to interact with other HER family members (HER1, HER2, HER3, and HER4) on the surface of cancer cells. The HER signaling pathway plays a role in the formation and growth of numerous cancers, and previous clinical trials of pertuzumab in a single agent setting had suggested clinical activity - including stable disease - in heavily pretreated patients with advanced ovarian and breast cancers.
Toxicity The most common adverse reactions (> 30%) with PERJETA in combination with trastuzumab and docetaxel were diarrhea, alopecia, neutropenia, nausea, fatigue, rash, and peripheral neuropathy.
Metabolism N.A.
Absorption When an initial dose of 840 mg followed by a maintenance dose of 420 mg every three weeks thereafter is administered, steady-state concentrations were achieved on the first maintenance dose.
Volume of Distribution 5.12 L
Clearance 0.24 L/day
Categories Monoclonal antibodies
Patents Number CA2376596
Date of Issue 07/10/13
Date of Expiry 24/06/24
Drug Interaction N.A.
Target Receptor tyrosine-protein kinase erbB-2
Information of corresponding available drug in the market
Brand Name Perjeta
Company Genentech
Brand Discription Pertuzumab is a recombinant humanized monoclonal antibody that targets the extracellular dimerization domain (Subdomain II) of the human epidermal growth factor receptor 2 protein (HER2). Pertuzumab is produced by recombinant DNA technology in a mammalian cell (Chinese Hamster Ovary) culture containing the antibiotic, gentamicin. Gentamicin is not detectable in the final product. Pertuzumab has an approximate molecular weight of 148 kDa.
Prescribed for Neoadjuvant Treatment of Breast Cancer, Metastatic Breast Cancer (MBC),
Chemical Name N.A.
Formulation Each single use vial contains 420 mg of pertuzumab at a concentration of 30 mg/mL in 20 mM L-histidine acetate (pH 6.0), 120 mM sucrose and 0.02% polysorbate 20
Physcial Appearance Sterile, clear to slightly opalescent, colorless to pale brown liquid
Route of Administration Intravenous infusion
Recommended Dosage The initial dose of PERJETA is 840 mg administered as a 60-minute Intravenous infusion, followed every 3 weeks by a dose of 420 mg administered as an Intravenous infusion over 30 to 60 minutes. When administered with PERJETA, the recommended initial dose of trastuzumab is 8 mg/kg administered as a 90-minute Intravenous infusion, followed every 3 weeks by a dose of 6 mg/kg administered as an Intravenous infusion over 30 to 90 minutes.PERJETA, trastuzumab, and docetaxel should be administered sequentially. PERJETA and trastuzumab can be given in any order. Docetaxel should be administered after PERJETA and trastuzumab. An observation period of 30 to 60 minutes is recommended after each PERJETA infusion and before commencement of any subsequent infusion of trastuzumab.
Contraindication N.A.
Side Effects Embryo-Fetal Toxicity , Left Ventricular Dysfunction , Infusion-Related Reactions, Hypersensitivity Reactions.
Useful Link http://www.rxlist.com/perjeta-drug.htm http://www.gene.com/download/pdf/perjeta_prescribing.pdf
PubMed ID 25572781, 25547504, 25542663, 25532690, 25494663
3-D Structure Th1121 Light chainor (Download), Th1121 Heavy chain (View) or (Download)

Entry 2
(2) Primary information
ID 1561
ThPP ID Th1121
Therapeutic Peptide/Protein Name Pertuzumab
Sequence light chain DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQ view full sequnce in fasta
Functional Classification IIIc
Molecular Weight N.A.
Chemical Formula N.A.
Isoelectric Point N.A.
Hydrophobicity N.A.
Melting Point (℃) N.A.
Half Life 18 days
Description Recombinant, humanized monoclonal antibody that targets the extracellular dimerization domain (Subdomain II) of the human epidermal growth factor receptor 2 protein (HER2). Two heavy chains and two lights chains are composed of 448 and 214 residues respectively. FDA approved June 8, 2012.
Indication/Disease Pertuzumab is indicated for use in combination with trastuzumab and docetaxel for the treatment of patients with HER2-positive metastatic breast cancer who have not received prior anti-HER2 therapy or chemotherapy for metastatic disease.
Pharmacodynamics N.A.
Mechanism of Action Pertuzumab is a humanized monoclonal antibody designed to bind to the HER2 receptor and inhibit the ability of HER2 to interact with other HER family members (HER1, HER2, HER3, and HER4) on the surface of cancer cells. The HER signaling pathway plays a role in the formation and growth of numerous cancers, and previous clinical trials of pertuzumab in a single agent setting had suggested clinical activity - including stable disease - in heavily pretreated patients with advanced ovarian and breast cancers.
Toxicity The most common adverse reactions (> 30%) with PERJETA in combination with trastuzumab and docetaxel were diarrhea, alopecia, neutropenia, nausea, fatigue, rash, and peripheral neuropathy.
Metabolism N.A.
Absorption When an initial dose of 840 mg followed by a maintenance dose of 420 mg every three weeks thereafter is administered, steady-state concentrations were achieved on the first maintenance dose.
Volume of Distribution 5.12 L
Clearance 0.24 L/day
Categories Monoclonal antibodies
Patents Number CA2579861
Date of Issue 19/12/16
Date of Expiry 20/10/29
Drug Interaction N.A.
Target N.A.
Information of corresponding available drug in the market
Brand Name N.A.
Company N.A.
Brand Discription N.A.
Prescribed for N.A.
Chemical Name N.A.
Formulation N.A.
Physcial Appearance N.A.
Route of Administration N.A.
Recommended Dosage N.A.
Contraindication N.A.
Side Effects N.A.
Useful Link N.A.
PubMed ID 25572781, 25547504, 25542663, 25532690, 25494663
3-D Structure Th1121 Light chainor (Download), Th1121 Heavy chain (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1560
ThPP ID	Th1121
Therapeutic Peptide/Protein Name	Pertuzumab
Sequence	light chain DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQ view full sequnce in fasta
Functional Classification	IIIc
Molecular Weight	148000
Chemical Formula	N.A.
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	18 days
Description	Recombinant, humanized monoclonal antibody that targets the extracellular dimerization domain (Subdomain II) of the human epidermal growth factor receptor 2 protein (HER2). Two heavy chains and two lights chains are composed of 448 and 214 residues respectively. FDA approved June 8, 2012.
Indication/Disease	Pertuzumab is indicated for use in combination with trastuzumab and docetaxel for the treatment of patients with HER2-positive metastatic breast cancer who have not received prior anti-HER2 therapy or chemotherapy for metastatic disease.
Pharmacodynamics	N.A.
Mechanism of Action	Pertuzumab is a humanized monoclonal antibody designed to bind to the HER2 receptor and inhibit the ability of HER2 to interact with other HER family members (HER1, HER2, HER3, and HER4) on the surface of cancer cells. The HER signaling pathway plays a role in the formation and growth of numerous cancers, and previous clinical trials of pertuzumab in a single agent setting had suggested clinical activity - including stable disease - in heavily pretreated patients with advanced ovarian and breast cancers.
Toxicity	The most common adverse reactions (> 30%) with PERJETA in combination with trastuzumab and docetaxel were diarrhea, alopecia, neutropenia, nausea, fatigue, rash, and peripheral neuropathy.
Metabolism	N.A.
Absorption	When an initial dose of 840 mg followed by a maintenance dose of 420 mg every three weeks thereafter is administered, steady-state concentrations were achieved on the first maintenance dose.
Volume of Distribution	5.12 L
Clearance	0.24 L/day
Categories	Monoclonal antibodies
Patents Number	CA2376596
Date of Issue	07/10/13
Date of Expiry	24/06/24
Drug Interaction	N.A.
Target	Receptor tyrosine-protein kinase erbB-2
Information of corresponding available drug in the market
Brand Name	Perjeta
Company	Genentech
Brand Discription	Pertuzumab is a recombinant humanized monoclonal antibody that targets the extracellular dimerization domain (Subdomain II) of the human epidermal growth factor receptor 2 protein (HER2). Pertuzumab is produced by recombinant DNA technology in a mammalian cell (Chinese Hamster Ovary) culture containing the antibiotic, gentamicin. Gentamicin is not detectable in the final product. Pertuzumab has an approximate molecular weight of 148 kDa.
Prescribed for	Neoadjuvant Treatment of Breast Cancer, Metastatic Breast Cancer (MBC),
Chemical Name	N.A.
Formulation	Each single use vial contains 420 mg of pertuzumab at a concentration of 30 mg/mL in 20 mM L-histidine acetate (pH 6.0), 120 mM sucrose and 0.02% polysorbate 20
Physcial Appearance	Sterile, clear to slightly opalescent, colorless to pale brown liquid
Route of Administration	Intravenous infusion
Recommended Dosage	The initial dose of PERJETA is 840 mg administered as a 60-minute Intravenous infusion, followed every 3 weeks by a dose of 420 mg administered as an Intravenous infusion over 30 to 60 minutes. When administered with PERJETA, the recommended initial dose of trastuzumab is 8 mg/kg administered as a 90-minute Intravenous infusion, followed every 3 weeks by a dose of 6 mg/kg administered as an Intravenous infusion over 30 to 90 minutes.PERJETA, trastuzumab, and docetaxel should be administered sequentially. PERJETA and trastuzumab can be given in any order. Docetaxel should be administered after PERJETA and trastuzumab. An observation period of 30 to 60 minutes is recommended after each PERJETA infusion and before commencement of any subsequent infusion of trastuzumab.
Contraindication	N.A.
Side Effects	Embryo-Fetal Toxicity , Left Ventricular Dysfunction , Infusion-Related Reactions, Hypersensitivity Reactions.
Useful Link	http://www.rxlist.com/perjeta-drug.htm http://www.gene.com/download/pdf/perjeta_prescribing.pdf
PubMed ID	25572781, 25547504, 25542663, 25532690, 25494663
3-D Structure	Th1121 Light chainor (Download), Th1121 Heavy chain (View) or (Download)

(2) Primary information
Entry 2
ID	1561
ThPP ID	Th1121
Therapeutic Peptide/Protein Name	Pertuzumab
Sequence	light chain DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQ view full sequnce in fasta
Functional Classification	IIIc
Molecular Weight	N.A.
Chemical Formula	N.A.
Isoelectric Point	N.A.
Hydrophobicity	N.A.
Melting Point (℃)	N.A.
Half Life	18 days
Description	Recombinant, humanized monoclonal antibody that targets the extracellular dimerization domain (Subdomain II) of the human epidermal growth factor receptor 2 protein (HER2). Two heavy chains and two lights chains are composed of 448 and 214 residues respectively. FDA approved June 8, 2012.
Indication/Disease	Pertuzumab is indicated for use in combination with trastuzumab and docetaxel for the treatment of patients with HER2-positive metastatic breast cancer who have not received prior anti-HER2 therapy or chemotherapy for metastatic disease.
Pharmacodynamics	N.A.
Mechanism of Action	Pertuzumab is a humanized monoclonal antibody designed to bind to the HER2 receptor and inhibit the ability of HER2 to interact with other HER family members (HER1, HER2, HER3, and HER4) on the surface of cancer cells. The HER signaling pathway plays a role in the formation and growth of numerous cancers, and previous clinical trials of pertuzumab in a single agent setting had suggested clinical activity - including stable disease - in heavily pretreated patients with advanced ovarian and breast cancers.
Toxicity	The most common adverse reactions (> 30%) with PERJETA in combination with trastuzumab and docetaxel were diarrhea, alopecia, neutropenia, nausea, fatigue, rash, and peripheral neuropathy.
Metabolism	N.A.
Absorption	When an initial dose of 840 mg followed by a maintenance dose of 420 mg every three weeks thereafter is administered, steady-state concentrations were achieved on the first maintenance dose.
Volume of Distribution	5.12 L
Clearance	0.24 L/day
Categories	Monoclonal antibodies
Patents Number	CA2579861
Date of Issue	19/12/16
Date of Expiry	20/10/29
Drug Interaction	N.A.
Target	N.A.
Information of corresponding available drug in the market
Brand Name	N.A.
Company	N.A.
Brand Discription	N.A.
Prescribed for	N.A.
Chemical Name	N.A.
Formulation	N.A.
Physcial Appearance	N.A.
Route of Administration	N.A.
Recommended Dosage	N.A.
Contraindication	N.A.
Side Effects	N.A.
Useful Link	N.A.
PubMed ID	25572781, 25547504, 25542663, 25532690, 25494663
3-D Structure	Th1121 Light chainor (Download), Th1121 Heavy chain (View) or (Download)