Detailed description page of THPdb

Details of Th1224 which contains 1 entries.

Entry 1
(1) Primary information
ID 1835
ThPP ID Th1224
Therapeutic Peptide/Protein Name Chorionic Gonadotropin (Recombinant)
Sequence Alpha chain : APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA view full sequnce in fasta
Functional Classification Ia
Molecular Weight 25719.7
Chemical Formula C1105H1770N318O336S26
Isoelectric Point 8.61
Hydrophobicity -0.258
Melting Point (℃) 55 Â°C
Half Life The mean terminal half-life is about 29 Â± 6 hours (initial half-life is 4.5 Â± 0.5 hours).
Description Recombinant human chorionic gonadotropin with 2 subunits, alpha = 92 residues, beta = 145 residues, each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.
Indication/Disease For the treatment of female infertility
Pharmacodynamics Choriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone.
Toxicity NA
Metabolism NA
Absorption The mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%.
Volume of Distribution 5.9 Â± 1.0 L
Clearance 0.29 +/- 0.04 L/h [healthy down-regulated females]
Categories Hormones
Patents Number US5767251
Date of Issue 16/06/95
Date of Expiry 16/06/15
Drug Interaction NA
Target Lutropin-choriogonadotropic hormone receptor, Follicle-stimulating hormone receptor
Information of corresponding available drug in the market
Brand Name Ovitrelle
Company Merck Serono Europe Limited
Brand Discription Ovitrelle is a medicine that contains the active substance choriogonadotropin alfa
Prescribed for Ovitrelle is indicated in the treatment of:women undergoing superovulation prior to assisted reproductive techniques such as in vitro fertilisation (IVF): Ovitrelle is administered to trigger final follicular maturation and luteinisation after stimulation of follicular growth;anovulatory or oligo-ovulatory women: Ovitrelle is administered to trigger ovulation and luteinisation in anovulatory or oligo-ovulatory patients after stimulation of follicular growth.
Chemical Name NA
Formulation Each pre-filled syringe contains 250 micrograms choriogonadotropin alfa* (equivalent to approximately 6,500 IU) in 0.5 mL solution
Physcial Appearance powder and solvent to be made up into a solution
Route of Administration Subcutaneous
Recommended Dosage One pre-filled syringe of Ovitrelle (250 micrograms) is administered 24 to 48 hours after the last administration of a follicle stimulating hormone (FSH) or human menopausal gonadotropin (hMG) preparation, i.e. when optimal stimulation of follicular growth is achieved.
Contraindication hypersensitive (allergic) to choriogonadotropin alfa or any of the other ingredients.
Side Effects The most common side effects with Ovitrelle (seen in between 1 and 10 patients in 100) are reactions at the injection site, headache, tiredness, vomiting, nausea (feeling sick), abdominal pain (stomach ache) and ovarian hyperstimulation syndrome (such as feeling sick, weight gain and diarrhoea). Ovarian hyperstimulation syndrome occurs when the ovaries over respond to treatment, especially when medicines to trigger ovulation have been used.
Useful Link https://www.drugs.com/uk/ovitrelle.html , https://www.medicines.org.uk/emc/medicine/14386
PubMed ID 12928375, 10636378
3-D Structure Th1224 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1835
ThPP ID	Th1224
Therapeutic Peptide/Protein Name	Chorionic Gonadotropin (Recombinant)
Sequence	Alpha chain : APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA view full sequnce in fasta
Functional Classification	Ia
Molecular Weight	25719.7
Chemical Formula	C1105H1770N318O336S26
Isoelectric Point	8.61
Hydrophobicity	-0.258
Melting Point (℃)	55 Â°C
Half Life	The mean terminal half-life is about 29 Â± 6 hours (initial half-life is 4.5 Â± 0.5 hours).
Description	Recombinant human chorionic gonadotropin with 2 subunits, alpha = 92 residues, beta = 145 residues, each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.
Indication/Disease	For the treatment of female infertility
Pharmacodynamics	Choriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of Action	Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone.
Toxicity	NA
Metabolism	NA
Absorption	The mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%.
Volume of Distribution	5.9 Â± 1.0 L
Clearance	0.29 +/- 0.04 L/h [healthy down-regulated females]
Categories	Hormones
Patents Number	US5767251
Date of Issue	16/06/95
Date of Expiry	16/06/15
Drug Interaction	NA
Target	Lutropin-choriogonadotropic hormone receptor, Follicle-stimulating hormone receptor
Information of corresponding available drug in the market
Brand Name	Ovitrelle
Company	Merck Serono Europe Limited
Brand Discription	Ovitrelle is a medicine that contains the active substance choriogonadotropin alfa
Prescribed for	Ovitrelle is indicated in the treatment of:women undergoing superovulation prior to assisted reproductive techniques such as in vitro fertilisation (IVF): Ovitrelle is administered to trigger final follicular maturation and luteinisation after stimulation of follicular growth;anovulatory or oligo-ovulatory women: Ovitrelle is administered to trigger ovulation and luteinisation in anovulatory or oligo-ovulatory patients after stimulation of follicular growth.
Chemical Name	NA
Formulation	Each pre-filled syringe contains 250 micrograms choriogonadotropin alfa* (equivalent to approximately 6,500 IU) in 0.5 mL solution
Physcial Appearance	powder and solvent to be made up into a solution
Route of Administration	Subcutaneous
Recommended Dosage	One pre-filled syringe of Ovitrelle (250 micrograms) is administered 24 to 48 hours after the last administration of a follicle stimulating hormone (FSH) or human menopausal gonadotropin (hMG) preparation, i.e. when optimal stimulation of follicular growth is achieved.
Contraindication	hypersensitive (allergic) to choriogonadotropin alfa or any of the other ingredients.
Side Effects	The most common side effects with Ovitrelle (seen in between 1 and 10 patients in 100) are reactions at the injection site, headache, tiredness, vomiting, nausea (feeling sick), abdominal pain (stomach ache) and ovarian hyperstimulation syndrome (such as feeling sick, weight gain and diarrhoea). Ovarian hyperstimulation syndrome occurs when the ovaries over respond to treatment, especially when medicines to trigger ovulation have been used.
Useful Link	https://www.drugs.com/uk/ovitrelle.html , https://www.medicines.org.uk/emc/medicine/14386
PubMed ID	12928375, 10636378
3-D Structure	Th1224 (View) or (Download)