Detailed description page of THPdb

Details of Th1233 which contains 1 entries.

Entry 1
(1) Primary information
ID 1845
ThPP ID Th1233
Therapeutic Peptide/Protein Name Pegloticase
Sequence TYKKNDEVEFVRTGYGKDMIKVLHIQRDGKYHSIKEVATTVQLTLSSKKD view full sequnce in fasta
Functional Classification Ib
Molecular Weight 34192.8533
Chemical Formula C1549H2430N408O448S8
Isoelectric Point NA
Hydrophobicity NA
Melting Point (℃) NA
Half Life Median: ~14 days
Description Pegloticase is a recombinant procine-like uricase drug indicated for the treatment of severe, treatment-refractory, chronic gout. Similarly to rasburicase, pegloticase metabolises the conversion of uric acid to allantoin. This reduces the risk of precipitate formation and development of gout, since allantoin is five to ten times more soluble than uric acid. In contrast to rasburicase, pegloticase is pegylated to increase its elimination half-life from about eight hours to ten or twelve days, and to decrease the immunogenicity of the foreign uricase protein. This modification allows for an application just once every two to four weeks, making this drug suitable for long-term treatment.
Indication/Disease For the treatment of chronic gout in adult patients refractory to conventional therapy.
Pharmacodynamics NA
Mechanism of Action Pegloticase is a recombinant uricase that catalyzes the metabolism of uric acid to allantoin.
Toxicity Conditions that should be monitored for when starting treatment with pegloticase include anaphylaxis, infusion reactions, an increase in gout flares, and/or an exacerbation of pre-existing congestive heart failure.
Metabolism NA
Absorption Approximately 24 hours following the first dose, mean plasma uric acid levels were 0.7 mg/dL. The duration of suppression of plasma uric acid appeared to be positively associated with pegloticase dose. Sustained decrease in plasma uric acid below the solubility concentration of 6 mg/dL for more than 300 hours was observed with doses of 8 mg and 12 mg.
Volume of Distribution NA
Clearance NA
Categories Enzymes
Patents Number NA
Date of Issue NA
Date of Expiry NA
Drug Interaction The risk or severity of adverse effects can be increased while combining Pegloticase with Allopurinol, Certolizumab pegol, Febuxostat, Pegademase bovine, Pegaptanib, Pegaspargase, Pegfilgrastim, Peginterferon alfa-2a, Peginterferon alfa-2b, Pegvisomant etc
Target Uric acid
Information of corresponding available drug in the market
Brand Name Pegloticase (Krystexxa)
Company NA
Brand Discription Pegloticase is a uric acid-specific enzyme (uricase). It works by allowing uric acid to be more easily removed from the body by the kidneys.
Prescribed for Treating chronic gout in certain patients
Chemical Name NA
Formulation NA
Physcial Appearance Solid
Route of Administration Intravenous
Recommended Dosage Gout: IV: 8 mg every 2 weeks
Contraindication Hypersensitivity to the active substance
Side Effects Chest pain or discomfort, cough, difficult or labored breathing, difficulty with swallowing, dizziness, facial swelling, fast heartbeat, fever or chills, flushing or redness of the skin, gout flare, headache, hives or welts, itching, or skin rash, nausea or vomiting, puffiness or swelling of the eyelids or around the eyes, face, lips, or tongue, redness of the skin, tightness in the chest, unusual tiredness or weakness, unusually warm skin
Useful Link http://www.rxlist.com/krystexxa-drug.htm , https://www.drugs.com/cdi/pegloticase.html , https://en.wikipedia.org/wiki/Pegloticase
PubMed ID 27493693
3-D Structure Th1233 (View) or (Download)

OSDDlinux

Raghava's Group

IMTECH

CSIR

CRDD
CPPSITE 2.0

(1) Primary information
Entry 1
ID	1845
ThPP ID	Th1233
Therapeutic Peptide/Protein Name	Pegloticase
Sequence	TYKKNDEVEFVRTGYGKDMIKVLHIQRDGKYHSIKEVATTVQLTLSSKKD view full sequnce in fasta
Functional Classification	Ib
Molecular Weight	34192.8533
Chemical Formula	C1549H2430N408O448S8
Isoelectric Point	NA
Hydrophobicity	NA
Melting Point (℃)	NA
Half Life	Median: ~14 days
Description	Pegloticase is a recombinant procine-like uricase drug indicated for the treatment of severe, treatment-refractory, chronic gout. Similarly to rasburicase, pegloticase metabolises the conversion of uric acid to allantoin. This reduces the risk of precipitate formation and development of gout, since allantoin is five to ten times more soluble than uric acid. In contrast to rasburicase, pegloticase is pegylated to increase its elimination half-life from about eight hours to ten or twelve days, and to decrease the immunogenicity of the foreign uricase protein. This modification allows for an application just once every two to four weeks, making this drug suitable for long-term treatment.
Indication/Disease	For the treatment of chronic gout in adult patients refractory to conventional therapy.
Pharmacodynamics	NA
Mechanism of Action	Pegloticase is a recombinant uricase that catalyzes the metabolism of uric acid to allantoin.
Toxicity	Conditions that should be monitored for when starting treatment with pegloticase include anaphylaxis, infusion reactions, an increase in gout flares, and/or an exacerbation of pre-existing congestive heart failure.
Metabolism	NA
Absorption	Approximately 24 hours following the first dose, mean plasma uric acid levels were 0.7 mg/dL. The duration of suppression of plasma uric acid appeared to be positively associated with pegloticase dose. Sustained decrease in plasma uric acid below the solubility concentration of 6 mg/dL for more than 300 hours was observed with doses of 8 mg and 12 mg.
Volume of Distribution	NA
Clearance	NA
Categories	Enzymes
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	The risk or severity of adverse effects can be increased while combining Pegloticase with Allopurinol, Certolizumab pegol, Febuxostat, Pegademase bovine, Pegaptanib, Pegaspargase, Pegfilgrastim, Peginterferon alfa-2a, Peginterferon alfa-2b, Pegvisomant etc
Target	Uric acid
Information of corresponding available drug in the market
Brand Name	Pegloticase (Krystexxa)
Company	NA
Brand Discription	Pegloticase is a uric acid-specific enzyme (uricase). It works by allowing uric acid to be more easily removed from the body by the kidneys.
Prescribed for	Treating chronic gout in certain patients
Chemical Name	NA
Formulation	NA
Physcial Appearance	Solid
Route of Administration	Intravenous
Recommended Dosage	Gout: IV: 8 mg every 2 weeks
Contraindication	Hypersensitivity to the active substance
Side Effects	Chest pain or discomfort, cough, difficult or labored breathing, difficulty with swallowing, dizziness, facial swelling, fast heartbeat, fever or chills, flushing or redness of the skin, gout flare, headache, hives or welts, itching, or skin rash, nausea or vomiting, puffiness or swelling of the eyelids or around the eyes, face, lips, or tongue, redness of the skin, tightness in the chest, unusual tiredness or weakness, unusually warm skin
Useful Link	http://www.rxlist.com/krystexxa-drug.htm , https://www.drugs.com/cdi/pegloticase.html , https://en.wikipedia.org/wiki/Pegloticase
PubMed ID	27493693
3-D Structure	Th1233 (View) or (Download)