A database of FDA approved therapeutic peptides and proteins
Details of Th1238 which contains 1 entries. |
| Entry 1 | |
| (1) Primary information | |
|---|---|
| ID | 1851 |
| ThPP ID | Th1238 |
| Therapeutic Peptide/Protein Name | Susoctocog alfa |
| Sequence | AIRRYYLGAVELSWDYRQSELLRELHVDTRFPATAPGALPLGPSVLYKKT view full sequnce in fasta |
| Functional Classification | Ib |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting Point (℃) | NA |
| Half Life | ~17 h |
| Description | Intravenous susoctocog alfa is a recombinant, B-domain deleted, porcine sequence antihaemophilic factor VIII (FVIII) product that has recently been approved for the treatment of bleeding episodes in adults with acquired haemophilia A (AHA). |
| Indication/Disease | For the treatment of Haemophilia A |
| Pharmacodynamics | Immediately after release in the patient’s circulation, Factor VIII binds to von Willebrand factor (vWF). The Factor VIII/von Willebrand factor complex consists of two molecules (Factor VIII and von Willebrand factor) with different physiological functions. Activated Factor VIII acts as a co-factor for activated Factor IX, accelerating the conversion of Factor X to activated Factor X, which ultimately converts prothrombin into thrombin. Thrombin then converts fibrinogen into fibrin and a clot can be formed. |
| Mechanism of Action | Blood coagulation factor replacements, Factor X stimulants |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| Volume of Distribution | NA |
| Clearance | NA |
| Categories | Blood coagulation factors, Antihaemorrhagics |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | von Willebrand factor |
| Information of corresponding available drug in the market | |
| Brand Name | Obizur |
| Company | NA |
| Brand Discription | OBIZUR (antihaemophilic Factor VIII (recombinant), porcine sequence) is a purified protein that has 1448 amino acids with an approximate molecular mass of 175kDa. It is produced by recombinant DNA (rDNA) technology in baby hamster kidney (BHK) cells. The BHK cells are cultured in media that contains fetal bovine serum. The manufacturing process is free of human serum and human protein products and does not contain any additional animal derived materials. |
| Prescribed for | It is indicated for the treatment of bleeding episodes in adults with acquired hemophilia A. |
| Chemical Name | NA |
| Formulation | Each powder vial contains nominally 500 Units of B domain deleted antihaemophilic Factor VIII (recombinant), porcine sequence, susoctocog alfa. |
| Physcial Appearance | Powder and solvent for solution for injection. |
| Route of Administration | Intravenous |
| Recommended Dosage | The recommended initial dose is 200 U per kilogram bodyweight, given by intravenous injection |
| Contraindication | life-threatening hypersensitivity reactionsto OBIZUR or its components, including hamster protein. |
| Side Effects | Hypersensitivity reactions, including anaphylaxis, may occur. Should symptoms occur, discontinue OBIZUR and administer appropriate treatment |
| Useful Link | https://www.baxter.com/assets/downloads/obizur_pI.pdf , http://www.obizur.com/ , http://drugspider.com/drug/susoctocog-alfa |
| PubMed ID | 27098420 |
| 3-D Structure | Th1238 (View) or (Download) |