Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID268 | FYESDVMGR | Alpha-2-macroglobulin | Plasma | 552.2415 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID269 | HGPEGLRV | Alpha-2-macroglobulin | Plasma | 432.7345 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID270 | VSFLSALEEYTK | Apolipoprotein A-I | Plasma | 693.858 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID271 | SFLSALEEYTK | Apolipoprotein A-I | Plasma | 644.3235 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID272 | SFLSALEEYT | Apolipoprotein A-I | Plasma | 580.276 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID273 | FLSALEEYTK | Apolipoprotein A-I | Plasma | 600.8075 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID274 | LEEYTKKLNTQ | Apolipoprotein A-I | Plasma | 683.861 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID275 | LEDLRQGLLPVLESF | Apolipoprotein A-I | Plasma | 864.977 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID276 | RQGLLPVLESF | Apolipoprotein A-I | Plasma | 629.858 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID277 | QGLLPVLESFKV | Apolipoprotein A-I | Plasma | 665.389 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID278 | QGLLPVLESFK | Apolipoprotein A-I | Plasma | 615.855 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID279 | LLPVLESFK | Apolipoprotein A-I | Plasma | 523.315 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID280 | THLAPYSDELRQR | Apolipoprotein A-I | Plasma | 529.2696667 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID281 | THLAPYSDELR | Apolipoprotein A-I | Plasma | 434.5496667 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID282 | HLAPYSDELR | Apolipoprotein A-I | Plasma | 600.8005 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID283 | HLAPYSDELRQR | Apolipoprotein A-I | Plasma | 495.587 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID284 | LLDNWDSVTSTFSK | Apolipoprotein A-I | Plasma | 806.893 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID285 | DVLKDSGRDYVSQ | Apolipoprotein A-I | Plasma | 494.5746667 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID286 | SEKAKPALEDLR | Apolipoprotein A-I | Plasma | 452.9163333 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID287 | ATKTAKDALSSVQESQVAQQ | Apolipoprotein C-III | Plasma | 697.3576667 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID288 | TAKDALSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | 1009.0155 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID289 | TAKDALSSVQESQVAQQA | Apolipoprotein C-III | Plasma | 930.965 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID290 | TAKDALSSVQESQVAQQ | Apolipoprotein C-III | Plasma | "895.45, 597.3" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID291 | TAKDALSSVQESQVAQ | Apolipoprotein C-III | Plasma | 831.4175 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID292 | TAKDALSSVQESQ | Apolipoprotein C-III | Plasma | 682.335 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID293 | TAKDALSSVQES | Apolipoprotein C-III | Plasma | 618.306 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID294 | KDALSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | 615.649 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID295 | KDALSSVQESQVAQQA | Apolipoprotein C-III | Plasma | 844.9225 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID296 | KDALSSVQESQVAQQ | Apolipoprotein C-III | Plasma | 809.404 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID297 | KDALSSVQESQVAQ | Apolipoprotein C-III | Plasma | 745.375 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID298 | DALSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | "858.93, 572.95" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID299 | DALSSVQESQVAQQA | Apolipoprotein C-III | Plasma | 780.8755 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID300 | DALSSVQESQVAQQ | Apolipoprotein C-III | Plasma | 745.3565 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID301 | DALSSVQESQVAQ | Apolipoprotein C-III | Plasma | 681.3275 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID302 | LSSVQESQVAQQAR | Apolipoprotein C-III | Plasma | 765.894 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID303 | SSVQESQVAQQARGWVTDGF | Apolipoprotein C-III | Plasma | 1090.5185 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID304 | DKFSEFWDLDPEVRPT | Apolipoprotein C-III | Plasma | "990.97, 660.98" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID305 | SEFWDLDPEVRPTSAVAA | Apolipoprotein C-III | Plasma | 995.478 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID306 | WDLDPEVRPTSAVAA | Apolipoprotein C-III | Plasma | 813.9065 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID307 | DLDPEVRPT | Apolipoprotein C-III | Plasma | 521.261 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID308 | SEAEDASLLSFMQGYMK | Apolipoprotein C-III | Plasma | 953.9285 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID309 | SEAEDASLLSFMQGY | Apolipoprotein C-III | Plasma | 824.3605 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID310 | SEAEDASLLSFM | Apolipoprotein C-III | Plasma | 650.289 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID311 | GWVTDGFSSLK | Apolipoprotein C-III | Plasma | 598.7975 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID312 | WVTDGFSSLK | Apolipoprotein C-III | Plasma | 570.287 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID313 | KVEQAVETEPEPELRQQ | Apolipoprotein E | Plasma | 670.6713333 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID314 | KVEQAVETEPEPELR | Apolipoprotein E | Plasma | 585.299 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID315 | KVEQAVETEPEPEL | Apolipoprotein E | Plasma | 799.398 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID316 | VEQAVETEPEPELRQQ | Apolipoprotein E | Plasma | 627.973 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID317 | LVEKVQAAVGTSAAPVPSDNH | Apolipoprotein E | Plasma | 697.3626667 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID318 | KVQAAVGTSAAPVPSD | Apolipoprotein E | Plasma | 749.3955 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID319 | VQAAVGTSAAPVPSDNH | Apolipoprotein E | Plasma | 810.899 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID320 | QAAVGTSAAPVPSDNH | Apolipoprotein E | Plasma | 761.365 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID321 | AAVGTSAAPVPSDNH | Apolipoprotein E | Plasma | 697.3355 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID322 | AATVGSLAGQPLQER | Apolipoprotein E | Plasma | 749.4015 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID323 | TVGSLAGQPLQERAQAWGER | Apolipoprotein E | Plasma | 718.702 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID324 | TVGSLAGQPLQERAQAW | Apolipoprotein E | Plasma | 906.47 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID325 | TVGSLAGQPLQERAQ | Apolipoprotein E | Plasma | "777.91, 518.94" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID326 | TVGSLAGQPLQERA | Apolipoprotein E | Plasma | 713.8825 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID327 | TVGSLAGQPLQER | Apolipoprotein E | Plasma | 678.364 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID328 | TVGSLAGQPL | Apolipoprotein E | Plasma | 471.763 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID329 | RLAVYQAGAREGAER | Apolipoprotein E | Plasma | 549.6243333 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID330 | LAVYQAGAREGAER | Apolipoprotein E | Plasma | 497.5906667 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID331 | LGPLVEQGR | Apolipoprotein E | Plasma | 484.7765 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID332 | SWFEPLVEDMQR | Apolipoprotein E | Plasma | 768.858 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID333 | ADDTWEPFASGKTSESGELH | Transthyretin | Plasma | 721.981 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID334 | ADDTWEPFASGK | Transthyretin | Plasma | 662.293 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID335 | DDTWEPFASGKTSESGELH | Transthyretin | Plasma | 698.3033333 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID336 | DDTWEPFASGKTSESGE | Transthyretin | Plasma | 921.8835 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID337 | SPAINVAVHV | Transthyretin | Plasma | 503.7845 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID338 | AINVAVHV | Transthyretin | Plasma | 411.742 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID339 | ASGKTSESGELHGLTTEEEF | Transthyretin | Plasma | 703.654 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID340 | GLTTEEEFVEGIYKVEIDTK | Transthyretin | Plasma | 1150.5775 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID341 | GLTTEEEFVEGIYK | Transthyretin | Plasma | 807.895 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID342 | VEGIYKVEI | Transthyretin | Plasma | 525.294 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID343 | SYSTTAVVTNPKE | Transthyretin | Plasma | 698.848 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID344 | FKDLGEENFK | Serum albumin | Plasma | 613.803 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID345 | DLGEENFK | Serum albumin | Plasma | 476.221 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID346 | KLVAASQAALGL | Serum albumin | Plasma | 571.3475 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID347 | LVAASQAALGL | Serum albumin | Plasma | 507.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID348 | KVPQVSTPTLVEVSR | Serum albumin | Plasma | 547.3126667 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID349 | GNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 919.12 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID350 | SLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Plasma | 695.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID351 | SLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | "964.48, 643.32" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID352 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Plasma | 886.43 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID353 | SLAELGGHLDQQ | Apolipoprotein A-IV | Plasma | 634.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID354 | AELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 864.42 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID355 | ELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 828.9 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID356 | ELGGHLDQQVEEF | Apolipoprotein A-IV | Plasma | 750.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID357 | GGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 707.84 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID358 | GGHLDQQVEEF | Apolipoprotein A-IV | Plasma | 629.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID359 | LAPLAEDVRGNLR | Apolipoprotein A-IV | Plasma | 712.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID360 | LAPLAEDVRGNL | Apolipoprotein A-IV | Plasma | 634.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID361 | LAPLAEDVR | Apolipoprotein A-IV | Plasma | 492.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID362 | TLSLPELEQQ | Apolipoprotein A-IV | Plasma | 579.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID363 | TLSLPELEQ | Apolipoprotein A-IV | Plasma | 515.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID364 | SLPELEQQQEQQQEQQQEQVQMLAPLES | Apolipoprotein A-IV | Plasma | 1108.19 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID365 | SLPELEQQQEQQQEQQQEQVQ | Apolipoprotein A-IV | Plasma | 861.07 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID366 | SLPELEQQQEQQQEQQQ | Apolipoprotein A-IV | Plasma | 1049.48 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID367 | SLPELEQQQEQQQ | Apolipoprotein A-IV | Plasma | 792.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID368 | ISASAEELRQR | Apolipoprotein A-IV | Plasma | 630.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID369 | ISASAEELR | Apolipoprotein A-IV | Plasma | 488.26 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID370 | ADEFKVKIDQTVEELR | Apolipoprotein A-IV | Plasma | "960.50, 640.67" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID371 | DEFKVKIDQTVEEL | Apolipoprotein A-IV | Plasma | 846.94 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID372 | KVKIDQTVEELR | Apolipoprotein A-IV | Plasma | 486.61 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID373 | VKIDQTVEELR | Apolipoprotein A-IV | Plasma | 665.37 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID374 | KIDQTVEELR | Apolipoprotein A-IV | Plasma | 615.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID375 | IDQTVEELR | Apolipoprotein A-IV | Plasma | 551.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID376 | RVEPYGENFNK | Apolipoprotein A-IV | Plasma | "676.83, 451.55" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID377 | RVEPYGENFN | Apolipoprotein A-IV | Plasma | 611.78 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID378 | GENFNKALVQQMEQL | Apolipoprotein A-IV | Plasma | "874.93, 583.62" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID379 | GDVEGHLSFLEKDLR | Apolipoprotein A-IV | Plasma | 572.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID380 | GDVEGHLSF | Apolipoprotein A-IV | Plasma | 480.72 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID381 | DQLRTQVSTQAEQL | Apolipoprotein A-IV | Plasma | 808.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID382 | TQVSTQAEQLR | Apolipoprotein A-IV | Plasma | 630.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID383 | LFQDKLGEVNTYAGDLQ | Apolipoprotein A-IV | Plasma | 955.98 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID384 | LFQDKLGEVNTY | Apolipoprotein A-IV | Plasma | 713.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID385 | LLPHANEVSQ | Apolipoprotein A-IV | Plasma | 554.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID386 | IGDNLRELQQRLEPY | Apolipoprotein A-IV | Plasma | 615.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID387 | SELTQQLNALF | Apolipoprotein A-IV | Plasma | 632.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID388 | SLAPYAQDTQEKLNHQLEGL | Apolipoprotein A-IV | Plasma | 752.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID389 | TGIFTDQVLSVLKGEE | Apolipoprotein C-II | Plasma | 868.46 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID390 | TGIFTDQVLSVL | Apolipoprotein C-II | Plasma | 646.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID391 | GIFTDQVLSVLKGEE | Apolipoprotein C-II | Plasma | 817.93 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID392 | GIFTDQVLSVL | Apolipoprotein C-II | Plasma | 596.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID393 | FTDQVLSVLKGEE | Apolipoprotein C-II | Plasma | 732.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID394 | TDQVLSVLKGEE | Apolipoprotein C-II | Plasma | 659.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID395 | DQVLSVLKGEE | Apolipoprotein C-II | Plasma | 608.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID396 | TQQPQQDEMPSPTF | Apolipoprotein C-II | Plasma | 817.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID397 | TQQPQQDEMPSPT | Apolipoprotein C-II | Plasma | 743.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID398 | FLTQVKESL | Apolipoprotein C-II | Plasma | 532.8 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID399 | SYWESAKTAAQ | Apolipoprotein C-II | Plasma | 621.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID400 | GSTGNRNPGSSGTGGTATWKPGSSGP | Fibrinogen alpha chain | Plasma | "1188.05, 792.37" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID401 | GSTGNRNPGSSGTGGTATWKPGSS | Fibrinogen alpha chain | Plasma | 741.01 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID402 | GSTGNRNPGSSGTGGTATWKPGS | Fibrinogen alpha chain | Plasma | 712 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID403 | STGNRNPGSSGTGGTATWKPGSSGP | Fibrinogen alpha chain | Plasma | "1159.54, 773.36" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID404 | TGNRNPGSSGTGGTATWKPGSSGP | Fibrinogen alpha chain | Plasma | "1116.02, 744.35" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID405 | TGNRNPGSSGTGGTATWKPGSS | Fibrinogen alpha chain | Plasma | 692.99 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID406 | TGNRNPGSSGTGGTATWKPGS | Fibrinogen alpha chain | Plasma | 663.98 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID407 | TGNRNPGSSGTGGTATWKPG | Fibrinogen alpha chain | Plasma | "951.903, 634.97" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID408 | TGNRNPGSSGTGGTATW | Fibrinogen alpha chain | Plasma | 810.87 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID409 | GNRNPGSSGTGGTATWKPGSSGP | Fibrinogen alpha chain | Plasma | "1065.5, 710.67" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID410 | GNRNPGSSGTGGTATWKPGS | Fibrinogen alpha chain | Plasma | 630.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID411 | GNRNPGSSGTGGTATWKP | Fibrinogen alpha chain | Plasma | 872.92 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID412 | NRNPGSSGTGGTATWKPGSSGP | Fibrinogen alpha chain | Plasma | 691.66 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID413 | NRNPGSSGTGGTATWKPGSS | Fibrinogen alpha chain | Plasma | 640.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID414 | NRNPGSSGTGGTATWKPGS | Fibrinogen alpha chain | Plasma | 611.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID415 | NRNPGSSGTGGTATWKPG | Fibrinogen alpha chain | Plasma | 872.92 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID416 | RNPGSSGTGGTATWKPGSSGP | Fibrinogen alpha chain | Plasma | "979.97, 653.64" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID417 | NPGSSGTGGTATWKPGSSGP | Fibrinogen alpha chain | Plasma | 901.92 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID418 | NPGSSGTGGTATWKPGSS | Fibrinogen alpha chain | Plasma | 824.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID419 | NPGSSGTGGTATWKPG | Fibrinogen alpha chain | Plasma | 737.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID420 | PGSSGTGGTATWKPGSSGP | Fibrinogen alpha chain | Plasma | 844.89 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID421 | PGSSGTGGTATWKPGSS | Fibrinogen alpha chain | Plasma | 767.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID422 | PGSSGTGGTATWKPG | Fibrinogen alpha chain | Plasma | 680.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID423 | SSGTGGTATWKPGSSGP | Fibrinogen alpha chain | Plasma | 767.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID424 | DEAAFFDTASTGKTFPGFFSPM | Fibrinogen alpha chain | Plasma | 1186.03 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID425 | DEAAFFDTASTGKTFPG | Fibrinogen alpha chain | Plasma | 881.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID426 | DEAAFFDTASTGK | Fibrinogen alpha chain | Plasma | 680.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID427 | FDTASTGKTFPGFFSPMLGEFV | Fibrinogen alpha chain | Plasma | 1192.07 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID428 | FDTASTGKTFPGFFSPMLGEF | Fibrinogen alpha chain | Plasma | 1142.53 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID429 | FDTASTGKTFPGFFSPML | Fibrinogen alpha chain | Plasma | 975.97 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID430 | FDTASTGKTFPGFFSPM | Fibrinogen alpha chain | Plasma | 919.42 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID431 | FDTASTGKTFPGFFSP | Fibrinogen alpha chain | Plasma | 853.9 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID432 | FDTASTGKTFPGFF | Fibrinogen alpha chain | Plasma | 761.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID433 | FDTASTGKTFPGF | Fibrinogen alpha chain | Plasma | 688.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID434 | FDTASTGKTFPG | Fibrinogen alpha chain | Plasma | 614.8 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID435 | FDTASTGKTFP | Fibrinogen alpha chain | Plasma | 586.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID436 | FDTASTGKTF | Fibrinogen alpha chain | Plasma | 537.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID437 | DTASTGKTFPGFFSPMLGEFV | Fibrinogen alpha chain | Plasma | "1118.53, 746.02" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID438 | DTASTGKTFPGFFSPMLGEF | Fibrinogen alpha chain | Plasma | "1069.00, 713.00" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID439 | DTASTGKTFPGFFSPMLG | Fibrinogen alpha chain | Plasma | 930.94 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID440 | DTASTGKTFPGFFSPML | Fibrinogen alpha chain | Plasma | 902.43 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID441 | DTASTGKTFPGFFSPM | Fibrinogen alpha chain | Plasma | 845.89 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID442 | DTASTGKTFPGFFSP | Fibrinogen alpha chain | Plasma | 780.37 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID443 | DTASTGKTFPGFFS | Fibrinogen alpha chain | Plasma | 731.84 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID444 | DTASTGKTFPGFF | Fibrinogen alpha chain | Plasma | 688.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID445 | DTASTGKTFPGF | Fibrinogen alpha chain | Plasma | 614.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID446 | TASTGKTFPGFFSPML | Fibrinogen alpha chain | Plasma | 844.92 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID447 | ASTGKTFPGFFSPMLGEFV | Fibrinogen alpha chain | Plasma | "1010.49, 674.00" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID448 | ASTGKTFPGFFSPMLGEF | Fibrinogen alpha chain | Plasma | 960.96 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID449 | ASTGKTFPGFFSPML | Fibrinogen alpha chain | Plasma | 794.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID450 | ASTGKTFPGFFSPM | Fibrinogen alpha chain | Plasma | 737.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID451 | STGKTFPGFFSPM | Fibrinogen alpha chain | Plasma | 702.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID452 | STGKTFPGFFSP | Fibrinogen alpha chain | Plasma | 636.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID453 | STGKTFPGFFS | Fibrinogen alpha chain | Plasma | 588.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID454 | TGKTFPGFFSPML | Fibrinogen alpha chain | Plasma | 715.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID455 | TGKTFPGFFSPM | Fibrinogen alpha chain | Plasma | 658.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID456 | TGKTFPGFFSP | Fibrinogen alpha chain | Plasma | 593.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID457 | TGKTFPGFFS | Fibrinogen alpha chain | Plasma | 544.77 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID458 | TGKTFPGFF | Fibrinogen alpha chain | Plasma | 501.255 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID459 | TGKTFPGF | Fibrinogen alpha chain | Plasma | 427.72 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID460 | GKTFPGFFSPM | Fibrinogen alpha chain | Plasma | 608.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID461 | GKTFPGFFSP | Fibrinogen alpha chain | Plasma | 542.77 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID462 | GKTFPGFFS | Fibrinogen alpha chain | Plasma | 494.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID463 | GKTFPGFF | Fibrinogen alpha chain | Plasma | 450.73 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID464 | KTFPGFFSP | Fibrinogen alpha chain | Plasma | 514.26 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID465 | KTFPGFFS | Fibrinogen alpha chain | Plasma | 465.74 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID466 | TFPGFFSPMLGEF | Fibrinogen alpha chain | Plasma | 738.84 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID467 | PGFFSPMLGEFVSETESRG | Fibrinogen alpha chain | Plasma | 1037.48 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID468 | GFFSPMLGEFV | Fibrinogen alpha chain | Plasma | 615.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID469 | GFFSPMLGEF | Fibrinogen alpha chain | Plasma | 566.26 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID470 | FFSPMLGEFV | Fibrinogen alpha chain | Plasma | 587.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID471 | FSPMLGEFVSETESR | Fibrinogen alpha chain | Plasma | 858.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID472 | MLGEFVSETESRGSESGIF | Fibrinogen alpha chain | Plasma | 1031.47 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID473 | MLGEFVSETESR | Fibrinogen alpha chain | Plasma | 692.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID474 | LGEFVSETESRGSESGIFTNTKES | Fibrinogen alpha chain | Plasma | 864.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID475 | LGEFVSETESRGSESGIFTNTK | Fibrinogen alpha chain | Plasma | 792.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID476 | LGEFVSETESRGSESGIFTNT | Fibrinogen alpha chain | Plasma | 1124.02 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID477 | LGEFVSETESRGSESGIFTN | Fibrinogen alpha chain | Plasma | 1073.5 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID478 | LGEFVSETESRGSESGIFT | Fibrinogen alpha chain | Plasma | 1016.48 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID479 | LGEFVSETESRGSESGIF | Fibrinogen alpha chain | Plasma | 965.95 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID480 | LGEFVSETESRGSESGI | Fibrinogen alpha chain | Plasma | 892.42 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID481 | LGEFVSETESRGSE | Fibrinogen alpha chain | Plasma | 763.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID482 | LGEFVSETESRG | Fibrinogen alpha chain | Plasma | 655.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID483 | LGEFVSETESR | Fibrinogen alpha chain | Plasma | 627.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID484 | GEFVSETESRGSESGIFTNTKES | Fibrinogen alpha chain | Plasma | 826.71 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID485 | GEFVSETESRGSESGIFTNTKE | Fibrinogen alpha chain | Plasma | 797.7 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID486 | GEFVSETESRGSESGIFTNTK | Fibrinogen alpha chain | Plasma | 754.68 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID487 | GEFVSETESRGSESGIFTNT | Fibrinogen alpha chain | Plasma | 1067.48 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID488 | GEFVSETESRGSESGIFT | Fibrinogen alpha chain | Plasma | 959.93 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID489 | GEFVSETESRGSESGIF | Fibrinogen alpha chain | Plasma | 909.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID490 | EFVSETESRGSESGIFTNTK | Fibrinogen alpha chain | Plasma | 735.68 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID491 | EFVSETESRGSESGIFTNT | Fibrinogen alpha chain | Plasma | 1038.97 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID492 | EFVSETESRGSESGIFTN | Fibrinogen alpha chain | Plasma | 988.44 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID493 | EFVSETESRGSESGIFT | Fibrinogen alpha chain | Plasma | 931.42 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID494 | EFVSETESRGSESGIF | Fibrinogen alpha chain | Plasma | 880.9 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID495 | GSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWN | Fibrinogen alpha chain | Plasma | 1046.45 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID496 | GSTGSWNSGSSGTGSTGNQNPGSPRPGSTGT | Fibrinogen alpha chain | Plasma | 946.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID497 | GSTGSWNSGSSGTGSTGNQNPGSPRPGSTG | Fibrinogen alpha chain | Plasma | 912.73 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID498 | GSTGSWNSGSSGTGSTGNQNPGSPRPGST | Fibrinogen alpha chain | Plasma | 893.72 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID499 | GSTGSWNSGSSGTGSTGNQNPGSPRPG | Fibrinogen alpha chain | Plasma | 831.03 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID500 | STGSWNSGSSGTGSTGNQNPGSPRPGSTGT | Fibrinogen alpha chain | Plasma | 927.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID501 | STGSWNSGSSGTGSTGNQNPGSPRPG | Fibrinogen alpha chain | Plasma | 812.02 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID502 | TGSWNSGSSGTGSTGNQNPGSPRPGSTGT | Fibrinogen alpha chain | Plasma | 898.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID503 | TGSWNSGSSGTGSTGNQNPGSPRPG | Fibrinogen alpha chain | Plasma | 783.01 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID504 | SWNSGSSGTGSTGNQNPGSPRPGSTGTWN | Fibrinogen alpha chain | Plasma | 945.74 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID505 | SWNSGSSGTGSTGNQNPGSPRPGSTGT | Fibrinogen alpha chain | Plasma | 845.7 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID506 | SWNSGSSGTGSTGNQNPGSPRPG | Fibrinogen alpha chain | Plasma | 730.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID507 | WNSGSSGTGSTGNQNPGSPRPGSTGT | Fibrinogen alpha chain | Plasma | 816.69 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID508 | NSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSE | Fibrinogen alpha chain | Plasma | 1007.1 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID509 | NSGSSGTGSTGNQNPGSPRPGSTGTWN | Fibrinogen alpha chain | Plasma | 854.71 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID510 | SGSSGTGSTGNQNPGSPRPGSTGTWNPGSSER | Fibrinogen alpha chain | Plasma | 1021.12 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID511 | SGSSGTGSTGNQNPGSPRPGSTGTWNPGSSE | Fibrinogen alpha chain | Plasma | 969.09 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID512 | SSGTGSTGNQNPGSPRPGSTGTWNPGSSER | Fibrinogen alpha chain | Plasma | 973.1 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID513 | SSGTGSTGNQNPGSPRPGSTGTWNPGSSE | Fibrinogen alpha chain | Plasma | 921.07 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID514 | SGTGSTGNQNPGSPRPGSTGTWNPGSSE | Fibrinogen alpha chain | Plasma | 892.06 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID515 | TGSTGNQNPGSPRPGSTGTWN | Fibrinogen alpha chain | Plasma | 1036.97 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID516 | PGSPRPGSTGTWNPGSSERGS | Fibrinogen alpha chain | Plasma | 690.99 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID517 | PGSPRPGSTGTWNPGSSE | Fibrinogen alpha chain | Plasma | 885.9 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID518 | GKSSSYSKQFTSSTSYNR | Fibrinogen alpha chain | Plasma | 672.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID519 | GKSSSYSKQFTSSTSYN | Fibrinogen alpha chain | Plasma | 620.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID520 | SSSYSKQFTSSTSYNRGDSTFESK | Fibrinogen alpha chain | Plasma | 894.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID521 | SSSYSKQFTSSTSYNRGDSTF | Fibrinogen alpha chain | Plasma | 1169.01 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID522 | SSSYSKQFTSSTSYNR | Fibrinogen alpha chain | Plasma | 915.42 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID523 | SSSYSKQFTSSTSYN | Fibrinogen alpha chain | Plasma | 837.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID524 | SSSYSKQFTSSTSY | Fibrinogen alpha chain | Plasma | 780.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID525 | SSYSKQFTSSTSYNR | Fibrinogen alpha chain | Plasma | 871.9 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID526 | SSYSKQFTSSTSYN | Fibrinogen alpha chain | Plasma | 793.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID527 | SSYSKQFTSSTSY | Fibrinogen alpha chain | Plasma | 736.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID528 | SYSKQFTSSTSYNRGDSTFESK | Fibrinogen alpha chain | Plasma | 836.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID529 | SYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha chain | Plasma | 793.68 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID530 | SYSKQFTSSTSYNR | Fibrinogen alpha chain | Plasma | 828.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID531 | SYSKQFTSSTSYN | Fibrinogen alpha chain | Plasma | 750.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID532 | SYSKQFTSSTSY | Fibrinogen alpha chain | Plasma | 693.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID533 | YSKQFTSSTSYN | Fibrinogen alpha chain | Plasma | 706.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID534 | YSKQFTSSTSY | Fibrinogen alpha chain | Plasma | 649.8 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID535 | SKQFTSSTSYNRGDSTFESK | Fibrinogen alpha chain | Plasma | 753.01 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID536 | SKQFTSSTSYNRGDSTFES | Fibrinogen alpha chain | Plasma | 1064.97 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID537 | KQFTSSTSYNRGDSTFESK | Fibrinogen alpha chain | Plasma | 724 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID538 | KQFTSSTSYNRGDSTFES | Fibrinogen alpha chain | Plasma | 1021.46 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID539 | KQFTSSTSYNRGDSTF | Fibrinogen alpha chain | Plasma | 609.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID540 | TSSTSYNRGDSTFESKSYK | Fibrinogen alpha chain | Plasma | 715.66 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID541 | TSSTSYNRGDSTFESKSY | Fibrinogen alpha chain | Plasma | 1008.94 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID542 | SSTSYNRGDSTFESKSYK | Fibrinogen alpha chain | Plasma | 681.98 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID543 | SSTSYNRGDSTFESKSY | Fibrinogen alpha chain | Plasma | 958.42 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID544 | SSTSYNRGDSTFES | Fibrinogen alpha chain | Plasma | 769.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID545 | STSYNRGDSTFESKSYK | Fibrinogen alpha chain | Plasma | "978.947, 652.96" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID546 | STSYNRGDSTFESKSY | Fibrinogen alpha chain | Plasma | 914.9 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID547 | TSYNRGDSTFESKSYK | Fibrinogen alpha chain | Plasma | 623.95 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID548 | TSYNRGDSTFESKSY | Fibrinogen alpha chain | Plasma | "871.38, 581.26" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID549 | SYNRGDSTFESKSYK | Fibrinogen alpha chain | Plasma | 590.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID550 | SYNRGDSTFESKSY | Fibrinogen alpha chain | Plasma | "820.86, 547.57" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID551 | NRGDSTFESKSYKM | Fibrinogen alpha chain | Plasma | "825.38, 550.59" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID552 | GDSTFESKSYKMADEAGSEADHEGTHSTKR | Fibrinogen alpha chain | Plasma | 1086.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID553 | GDSTFESKSYKMAD | Fibrinogen alpha chain | Plasma | 783.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID554 | GDSTFESKSYKMA | Fibrinogen alpha chain | Plasma | 752.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID555 | GDSTFESKSYKM | Fibrinogen alpha chain | Plasma | 690.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID556 | GDSTFESKSYK | Fibrinogen alpha chain | Plasma | 624.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID557 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Plasma | 1080.51 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID558 | SYKMADEAGSEADHEGTHSTKRGHAK | Fibrinogen alpha chain | Plasma | 934.09 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID559 | SYKMADEAGSEADHEGTHSTKRGHA | Fibrinogen alpha chain | Plasma | 891.392 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID560 | SYKMADEAGSEADHEGTHSTKR | Fibrinogen alpha chain | Plasma | 803.02 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID561 | SYKMADEAGSEADHEGTHSTK | Fibrinogen alpha chain | Plasma | 750.99 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID562 | SYKMADEAGSEADHEGTHST | Fibrinogen alpha chain | Plasma | 1061.93 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID563 | SYKMADEAGSEADHEGTH | Fibrinogen alpha chain | Plasma | 645.59 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID564 | SETESRGSESGIFTNTKESSSHHPGIAEFPSRGK | Fibrinogen alpha chain | Plasma | "1211.91, 909.18" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID565 | SETESRGSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Plasma | "1169.21, 877.16" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID566 | SETESRGSESGIFTNTKESSSHHPGIAEFPSR | Fibrinogen alpha chain | Plasma | "1150.20, 862.90" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID567 | SETESRGSESGIFTNTKESS | Fibrinogen alpha chain | Plasma | "1066.98, 711.65" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID568 | SETESRGSESGIFTNTKES | Fibrinogen alpha chain | Plasma | "1023.46, 682.64" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID569 | SETESRGSESGIFTNT | Fibrinogen alpha chain | Plasma | 851.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID570 | GSESGIFTNTKESSSHHPGIAEFPSRGK | Fibrinogen alpha chain | Plasma | "982.14, 736.85" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID571 | GSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Plasma | "939.44, 704.83" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID572 | GSESGIFTNTKESSSHHPGIAEFPSR | Fibrinogen alpha chain | Plasma | "920.43, 690.58" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID573 | GSESGIFTNTKESSSHHPGIAEFPS | Fibrinogen alpha chain | Plasma | 868.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID574 | TNTKESSSHHPGIAEFPSRGK | Fibrinogen alpha chain | Plasma | 756.37 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID575 | TNTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Plasma | 713.67 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID576 | TNTKESSSHHPGIAEFPSR | Fibrinogen alpha chain | Plasma | 694.67 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID577 | TKESSSHHPGIAEFPSR | Fibrinogen alpha chain | Plasma | 622.97 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID578 | KESSSHHPGIAEFPSR | Fibrinogen alpha chain | Plasma | 589.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID579 | ESSSHHPGIAEFPSR | Fibrinogen alpha chain | Plasma | 546.59 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID580 | SGIFTNTKESSSHHPGIA | Fibrinogen alpha chain | Plasma | 623.97 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID581 | NTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Plasma | 679.99 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID582 | NTKESSSHHPGIAEFPSR | Fibrinogen alpha chain | Plasma | 660.98 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID583 | NTKESSSHHPGIAEFPS | Fibrinogen alpha chain | Plasma | 608.95 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID584 | SSHHPGIAEFPSRGK | Fibrinogen alpha chain | Plasma | 536.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID585 | SHHPGIAEFPSRGK | Fibrinogen alpha chain | Plasma | 507.26 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID586 | SSHHPGIAEFPSRG | Fibrinogen alpha chain | Plasma | 493.57 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID587 | SSHHPGIAEFPSR | Fibrinogen alpha chain | Plasma | "711.35, 474.56" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID588 | SHHPGIAEFPSR | Fibrinogen alpha chain | Plasma | 445.55 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID589 | GSAGHWTSESSVSGSTGQWH | Fibrinogen alpha chain | Plasma | 1022.94 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID590 | HWTSESSVSGSTGQWH | Fibrinogen alpha chain | Plasma | 886.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID591 | WTSESSVSGSTGQWH | Fibrinogen alpha chain | Plasma | 818.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID592 | SESSVSGSTGQWHSESGSFRPDSPGSGN | Fibrinogen alpha chain | Plasma | 937.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID593 | SVSGSTGQWHSESGSFRPDSPGSGNA | Fibrinogen alpha chain | Plasma | 860.04 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID594 | SVSGSTGQWHSESGSFRPDSPGSGN | Fibrinogen alpha chain | Plasma | 836.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID595 | SGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTF | Fibrinogen alpha chain | Plasma | 1192.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID596 | SESGSFRPDSPGSGNARPNNPDWGTFEEVSGN | Fibrinogen alpha chain | Plasma | 1117.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID597 | SESGSFRPDSPGSGNARPNNPDWGTFEEV | Fibrinogen alpha chain | Plasma | 1031.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID598 | SESGSFRPDSPGSGNARPNNPDWGTF | Fibrinogen alpha chain | Plasma | 912.73 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID599 | SESGSFRPDSPGSGNARPNNPDWGT | Fibrinogen alpha chain | Plasma | 863.71 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID600 | SESGSFRPDSPGSGNARPNNPDWG | Fibrinogen alpha chain | Plasma | 830.03 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID601 | SESGSFRPDSPGSGNARPNNPD | Fibrinogen alpha chain | Plasma | 749 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID602 | SESGSFRPDSPGSGNARPNN | Fibrinogen alpha chain | Plasma | 678.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID603 | SESGSFRPDSPGSGNARPN | Fibrinogen alpha chain | Plasma | 640.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID604 | SESGSFRPDSPGSGNARP | Fibrinogen alpha chain | Plasma | "902.91, 602.27" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID605 | SESGSFRPDSPGSGNA | Fibrinogen alpha chain | Plasma | 776.334 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID606 | ESGSFRPDSPGSGNARPNNPDWGTFEEV | Fibrinogen alpha chain | Plasma | 1002.78 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID607 | SGSFRPDSPGSGNARPNNPDWGTFE | Fibrinogen alpha chain | Plasma | 883.72 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID608 | SFRPDSPGSGNARP | Fibrinogen alpha chain | Plasma | 482.23 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID609 | DSPGSGNARPNNPDWGTF | Fibrinogen alpha chain | Plasma | 944.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID610 | ARPNNPDWGTFEEVSGNVSPGTR | Fibrinogen alpha chain | Plasma | 829.72 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID611 | ARPNNPDWGTFEEV | Fibrinogen alpha chain | Plasma | 816.37 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID612 | PNNPDWGTFEEVSGNVSPGTR | Fibrinogen alpha chain | Plasma | 754.01 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID613 | NNPDWGTFEEVSGNVSPGT | Fibrinogen alpha chain | Plasma | 1003.94 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID614 | PDWGTFEEVSGNVSPGTR | Fibrinogen alpha chain | Plasma | 967.94 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID615 | DWGTFEEVSGNVSPGTR | Fibrinogen alpha chain | Plasma | 919.42 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID616 | DWGTFEEVSGNVSPGT | Fibrinogen alpha chain | Plasma | 841.37 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID617 | WGTFEEVSGNVSPGT | Fibrinogen alpha chain | Plasma | 783.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID618 | TFEEVSGNVSPGT | Fibrinogen alpha chain | Plasma | 662.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID619 | REYHTEKLVTSKGDKELR | Fibrinogen alpha chain | Plasma | 730.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID620 | REYHTEKLVTSKGDKEL | Fibrinogen alpha chain | Plasma | 678.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID621 | MKPVPDLVPGNFK | Fibrinogen alpha chain | Plasma | "743.04, 495.69" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID622 | MKPVPDLVPGNF | Fibrinogen alpha chain | Plasma | 657.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID623 | HHPGIAEFPSRGK | Fibrinogen alpha chain | Plasma | 478.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID624 | HHPGIAEFPSRG | Fibrinogen alpha chain | Plasma | 435.55 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID625 | HHPGIAEFPSR | Fibrinogen alpha chain | Plasma | "624.31, 416.54" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID626 | GIAEFPSRG | Fibrinogen alpha chain | Plasma | 467.24 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID627 | GIAEFPSR | Fibrinogen alpha chain | Plasma | 438.73 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID628 | DSHSLTTNIMEILR | Fibrinogen alpha chain | Plasma | 815.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID629 | DSHSLTTNIMEI | Fibrinogen alpha chain | Plasma | 680.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID630 | TNIMEILR | Fibrinogen alpha chain | Plasma | 495.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID631 | ADSGEGDFLAEGGGVRGPR | Fibrinogen alpha chain | Plasma | "616.29, 411.19" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID632 | ADSGEGDFLAEGGGVRGP | Fibrinogen alpha chain | Plasma | 845.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID633 | ADSGEGDFLAEGGGVR | Fibrinogen alpha chain | Plasma | 768.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID634 | ADSGEGDFLAEGGGV | Fibrinogen alpha chain | Plasma | 690.8 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID635 | DSGEGDFLAEGGGVRGPR | Fibrinogen alpha chain | Plasma | 592.61 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID636 | DSGEGDFLAEGGGVRGP | Fibrinogen alpha chain | Plasma | 810.37 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID637 | DSGEGDFLAEGGGVR | Fibrinogen alpha chain | Plasma | 733.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID638 | DSGEGDFLAEGGGV | Fibrinogen alpha chain | Plasma | 655.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID639 | SGEGDFLAEGGGVR | Fibrinogen alpha chain | Plasma | 675.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID640 | SGEGDFLAEGGGV | Fibrinogen alpha chain | Plasma | 597.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID641 | GEGDFLAEGGGVRGP | Fibrinogen alpha chain | Plasma | 709.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID642 | GEGDFLAEGGGVR | Fibrinogen alpha chain | Plasma | 632.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID643 | EGDFLAEGGGVR | Fibrinogen alpha chain | Plasma | 603.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID644 | GDFLAEGGGVR | Fibrinogen alpha chain | Plasma | 539.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID645 | DFLAEGGGVR | Fibrinogen alpha chain | Plasma | 510.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID646 | MDLGTLSGIGTLDGFR | Fibrinogen alpha chain | Plasma | 826.92 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID647 | DLGTLSGIGTLDGFRHRHPDEAAF | Fibrinogen alpha chain | Plasma | 861.43 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID648 | DLGTLSGIGTLDGFRHRHPDEA | Fibrinogen alpha chain | Plasma | 788.72 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID649 | DLGTLSGIGTLDGFRH | Fibrinogen alpha chain | Plasma | 829.93 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID650 | DLGTLSGIGTLDGFR | Fibrinogen alpha chain | Plasma | 791.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID651 | DLGTLSGIGTLDGF | Fibrinogen alpha chain | Plasma | 683.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID652 | DLGTLSGIGTLDG | Fibrinogen alpha chain | Plasma | 609.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID653 | DLGTLSGIGTLD | Fibrinogen alpha chain | Plasma | 581.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID654 | DLGTLSGIGTL | Fibrinogen alpha chain | Plasma | 523.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID655 | DLGTLSGIGT | Fibrinogen alpha chain | Plasma | 467.24 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID656 | LGTLSGIGTLDGFR | Fibrinogen alpha chain | Plasma | 703.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID657 | LGTLSGIGTLDGF | Fibrinogen alpha chain | Plasma | 625.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID658 | LGTLSGIGTLD | Fibrinogen alpha chain | Plasma | 523.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID659 | GTLSGIGTLDGFRHRHPDEAAF | Fibrinogen alpha chain | Plasma | 785.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID660 | GTLSGIGTLDGFR | Fibrinogen alpha chain | Plasma | 647.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID661 | TLSGIGTLDGFR | Fibrinogen alpha chain | Plasma | 618.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID662 | TLSGIGTLDGF | Fibrinogen alpha chain | Plasma | 540.78 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID663 | SGIGTLDGFRHRHPDEAAF | Fibrinogen alpha chain | Plasma | 695 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID664 | SGIGTLDGFR | Fibrinogen alpha chain | Plasma | 341.18 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID665 | GIGTLDGFR | Fibrinogen alpha chain | Plasma | 468.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID666 | IGTLDGFR | Fibrinogen alpha chain | Plasma | 439.74 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID667 | HRHPDEAAFFDTASTGK | Fibrinogen alpha chain | Plasma | "943.94, 629.63" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID668 | HRHPDEAAFFDTA | Fibrinogen alpha chain | Plasma | 757.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID669 | HRHPDEAAFFDT | Fibrinogen alpha chain | Plasma | 721.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID670 | HRHPDEAAFF | Fibrinogen alpha chain | Plasma | 613.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID671 | SQLQKVPPEWKALTDMPQMR | Fibrinogen alpha chain | Plasma | 795.07 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID672 | SQLQKVPPEWKALTDMPQM | Fibrinogen alpha chain | Plasma | 743.04 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID673 | SQLQKVPPEWKALTD | Fibrinogen alpha chain | Plasma | 580.64 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID674 | SQLQKVPPEWKAL | Fibrinogen alpha chain | Plasma | 508.61 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID675 | SQLQKVPPEWK | Fibrinogen alpha chain | Plasma | "670.36, 447.24" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID676 | VPPEWKALTDMPQMR | Fibrinogen alpha chain | Plasma | 600.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID677 | VPPEWKALTDMPQM | Fibrinogen alpha chain | Plasma | 821.89 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID678 | ALTDMPQMRMELERPGGNEITR | Fibrinogen alpha chain | Plasma | 849.07 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID679 | ALTDMPQMRM | Fibrinogen alpha chain | Plasma | 597.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID680 | ALTDMPQM | Fibrinogen alpha chain | Plasma | 453.7 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID681 | LTDMPQMRM | Fibrinogen alpha chain | Plasma | 561.75 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID682 | LTDMPQMR | Fibrinogen alpha chain | Plasma | 496.23 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID683 | MELERPGGNEITRGGSTSY | Fibrinogen alpha chain | Plasma | 685.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID684 | MELERPGGNEITR | Fibrinogen alpha chain | Plasma | 751.37 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID685 | MELERPGGNEIT | Fibrinogen alpha chain | Plasma | 673.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID686 | MELERPGGNEI | Fibrinogen alpha chain | Plasma | 622.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID687 | ELERPGGNEITR | Fibrinogen alpha chain | Plasma | "685.85, 457.56" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID688 | ELERPGGNEIT | Fibrinogen alpha chain | Plasma | 607.8 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID689 | GGNEITRGGSTSYGTGSETE | Fibrinogen alpha chain | Plasma | 980.42 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID690 | EITRGGSTSYGTGSETESPRNPSSAGSWNSGSSGP | Fibrinogen alpha chain | Plasma | 1148.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID691 | GGSTSYGTGSETESPRNPSSAGSWNSGSSGPGSTGNR | Fibrinogen alpha chain | Plasma | 1173.16 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID692 | GGSTSYGTGSETESPRNPSSAGSWNSGSSGPGSTGN | Fibrinogen alpha chain | Plasma | 1121.13 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID693 | GGSTSYGTGSETESPRNPSSAGSWNSGSSGP | Fibrinogen alpha chain | Plasma | 982.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID694 | GGSTSYGTGSETESPRNPSSAGSWNSGS | Fibrinogen alpha chain | Plasma | 902.04 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID695 | GGSTSYGTGSETESPRNPSSAGSWNSG | Fibrinogen alpha chain | Plasma | 873.03 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID696 | GGSTSYGTGSETESPRNPSSAGSWN | Fibrinogen alpha chain | Plasma | 825.02 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID697 | GGSTSYGTGSETESPRNPSSAG | Fibrinogen alpha chain | Plasma | 1043.44 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID698 | GGSTSYGTGSETESPRNPSS | Fibrinogen alpha chain | Plasma | 979.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID699 | STSYGTGSETESPRNPSSAGSWNSGSSGP | Fibrinogen alpha chain | Plasma | 944.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID700 | YGTGSETESPRNPSSAGSWNSGSSGP | Fibrinogen alpha chain | Plasma | 852.69 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID701 | GTGSETESPRNPSSAGSWNSGSSGPGSTGNR | Fibrinogen alpha chain | Plasma | 989.09 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID702 | GTGSETESPRNPSSAGSWNSGSSGP | Fibrinogen alpha chain | Plasma | "1197.01, 798.34" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID703 | GTGSETESPRNPSSAGSWN | Fibrinogen alpha chain | Plasma | 960.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID704 | TGSETESPRNPSSAGSWNSGSSGP | Fibrinogen alpha chain | Plasma | 1168.5 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID705 | TGSETESPRNPSSAGSWNSG | Fibrinogen alpha chain | Plasma | 1004.43 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID706 | SETESPRNPSSAGSWNSG | Fibrinogen alpha chain | Plasma | 925.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID707 | AAWGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Plasma | 681.67 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID708 | WGKVGAHAGEYGAEALER | Hemoglobin subunit alpha | Plasma | "950.97, 634.31" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID709 | KVGAHAGEYGAEALER | Hemoglobin subunit alpha | Plasma | 553.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID710 | VGAHAGEYGAEALER | Hemoglobin subunit alpha | Plasma | 510.57 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID711 | AHAGEYGAEALERMFLSF | Hemoglobin subunit alpha | Plasma | 666.98 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID712 | GEYGAEALERMFLSFPTTK | Hemoglobin subunit alpha | Plasma | 716.5 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID713 | GEYGAEALERMFLSF | Hemoglobin subunit alpha | Plasma | 860.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID714 | GEYGAEALERMFL | Hemoglobin subunit alpha | Plasma | 743.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID715 | GEYGAEALERMF | Hemoglobin subunit alpha | Plasma | 686.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID716 | GEYGAEALERM | Hemoglobin subunit alpha | Plasma | 613.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID717 | TYFPHFDLSHGSAQVK | Hemoglobin subunit alpha | Plasma | 611.96 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID718 | TYFPHFDLSHGSAQV | Hemoglobin subunit alpha | Plasma | 853.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID719 | TYFPHFDLS | Hemoglobin subunit alpha | Plasma | 563.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID720 | SLDKFLASVST | Hemoglobin subunit alpha | Plasma | 584.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID721 | SLDKFLASV | Hemoglobin subunit alpha | Plasma | 490.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID722 | HLPAEFTPAVHA | Hemoglobin subunit alpha | Plasma | 645.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID723 | DALTNAVAHV | Hemoglobin subunit alpha | Plasma | 505.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID724 | ALTNAVAHVDDMPNALSALSD | Hemoglobin subunit alpha | Plasma | 1063.01 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID725 | VHLTPEEKSAVTALWGKVNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 1054.55 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID726 | VHLTPEEKSAVTALWGK | Hemoglobin subunit beta | Plasma | 622.67 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID727 | LTPEEKSAVTALWGKVNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 975.84 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID728 | SAVTALWGKVNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 743.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID729 | SAVTALWGKVNVDEVGGEALG | Hemoglobin subunit beta | Plasma | 1036.53 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID730 | SAVTALWGK | Hemoglobin subunit beta | Plasma | 466.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID731 | TALWGKVNVDEV | Hemoglobin subunit beta | Plasma | 665.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID732 | TALWGKVNV | Hemoglobin subunit beta | Plasma | 494.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID733 | KVNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 481.59 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID734 | VNVDEVGGEALGR | Hemoglobin subunit beta | Plasma | 657.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID735 | DEVGGEALGRLLV | Hemoglobin subunit beta | Plasma | 664.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID736 | DEVGGEALGRLL | Hemoglobin subunit beta | Plasma | 614.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID737 | SSRIGEIKEETTSHLR | Kininogen-1 | Plasma | 614.99 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID738 | IGEIKEETTSHLR | Kininogen-1 | Plasma | 504.93 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID739 | RPPGFSPFR | Kininogen-1 | Plasma | 530.78 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID740 | RPPGFSPF | Kininogen-1 | Plasma | 452.74 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID741 | DDDLEHQGGHVLDHGHKH | Kininogen-1 | Plasma | 682.64 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID742 | DDDLEHQGGHVLDHGH | Kininogen-1 | Plasma | 594.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID743 | DDDLEHQGGHVLDH | Kininogen-1 | Plasma | "793.84, 529.56" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID744 | VFSNGADLSGVTEEAPLKLS | Alpha-1-antitrypsin | Plasma | 1017.52 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID745 | DLSGVTEEAPLKLS | Alpha-1-antitrypsin | Plasma | 729.89 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID746 | TLNQPDSQLQLTTGN | Alpha-1-antitrypsin | Plasma | 815.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID747 | SPLFMGKVVNPTQK | Alpha-1-antitrypsin | Plasma | 515.95 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID748 | SPLFMGKVVNPTQ | Alpha-1-antitrypsin | Plasma | 709.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID749 | GNPTVEVDLFTSKGLFR | Alpha-enolase | Plasma | 940.49 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID750 | GNPTVEVDLFTSKGLF | Alpha-enolase | Plasma | 862.44 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID751 | GNPTVEVDLFTSK | Alpha-enolase | Plasma | 703.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID752 | SYDLDPGAGSLEI | Apolipoprotein F | Plasma | 668.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID753 | AISAALKPALR | Apolipoprotein F | Plasma | 555.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID754 | AISAALKPAL | Apolipoprotein F | Plasma | 477.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID755 | SYFVELGTQPATQ | Apolipoprotein A-II | Plasma | 720.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID756 | SYFVELGTQPAT | Apolipoprotein A-II | Plasma | 656.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID757 | YFVELGTQPAT | Apolipoprotein A-II | Plasma | 613.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID758 | FVELGTQPATQ | Apolipoprotein A-II | Plasma | 595.8 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID759 | REWFSETFQK | Apolipoprotein C-I | Plasma | 679.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID760 | REWFSETFQ | Apolipoprotein C-I | Plasma | 615.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID761 | TPDVSSALDKL | Apolipoprotein C-I | Plasma | 573.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID762 | DVSSALDKLKEFGNTLEDK | Apolipoprotein C-I | Plasma | 703.69 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID763 | DVSSALDKLKEFGN | Apolipoprotein C-I | Plasma | 761.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID764 | DVSSALDKLKEF | Apolipoprotein C-I | Plasma | 676.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID765 | DVSSALDKL | Apolipoprotein C-I | Plasma | 474.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID766 | AEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 602.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID767 | NVKENIQDNISLF | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 767.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID768 | FYNQVSTPLLR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 669.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID769 | YYLQGAKIPKPEA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 493.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID770 | YLQGAKIPKPEAS | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | "701.38, 467.92" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID771 | YLQGAKIPKPEA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 438.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID772 | QGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 538.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID773 | KIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 452.92 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID774 | PGVLSSRQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 703.7 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID775 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 786.72 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID776 | SSRQLGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 605.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID777 | SSRQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 581.63 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID778 | SRQLGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 576.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID779 | SRQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 552.6 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID780 | RQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 728.7 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID781 | RQLGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 547.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID782 | RQLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 523.61 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID783 | QLGLPGPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 728.69 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID784 | QLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 676.66 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID785 | QLGLPGPPDVPDHAAY | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 823.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID786 | QLGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 742.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID787 | QLGLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 706.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID788 | LGLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 678.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID789 | GLPGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 621.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID790 | GLPGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 586.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID791 | GLPGPPDVPDH | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 550.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID792 | GLPGPPDVPD | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 482.23 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID793 | PGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 808.87 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID794 | PGPPDVPDHAA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 536.75 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID795 | PGPPDVPDHA | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 501.23 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID796 | GPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 559.26 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID797 | GPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 760.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID798 | GPPDVPDHAAYHP | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 686.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID799 | GPPDVPDHAAY | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 569.75 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID800 | PDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 527.73 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID801 | PGVLSSRQL | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 478.77 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID802 | GPDVLTATVSGK | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 572.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID803 | GSEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | "695.35, 463.90" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID804 | GSEMVVAGKLQD | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 617.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID805 | GSEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 559.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID806 | SEMVVAGKLQDR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 444.89 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID807 | SEMVVAGKLQD | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 588.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID808 | SEMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 531.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID809 | EMVVAGKLQD | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 545.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID810 | EMVVAGKLQ | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 487.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID811 | MNFRPGVLSSR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 632.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID812 | MNFRPGVLS | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 510.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID813 | MNFRPGVL | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 467.24 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID814 | NFRPGVLSSR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 566.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID815 | NFRPGVLS | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 445.24 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID816 | FRPGVLSSR | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 509.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID817 | GVLSSRQL | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 430.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID818 | GAAGSRMNFRPGVLSS | Inter-alpha-trypsin inhibitor heavy chain H4 | Plasma | 536.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID819 | AEDHFSVIDFNQNIR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 602.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID820 | NVKENIQDNISLF | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 767.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID821 | FYNQVSTPLLR | Inter-alpha-trypsin inhibitor heavy chain H2 | Plasma | 669.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID822 | NEQEQPLGQWHLS | Sulfhydryl oxidase 1 | Plasma | 783.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | "Uniquely present in 16/23 patients, absent in normal" | 19795908 |
| CancerPDF_ID823 | AAPGQEPPEHMAELQR | Sulfhydryl oxidase 1 | Plasma | 880.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | "Uniquely present in 16/23 patients, absent in normal" | 19795908 |
| CancerPDF_ID824 | AAPGQEPPEHMAELQ | Sulfhydryl oxidase 1 | Plasma | 802.87 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | "Uniquely present in 16/23 patients, absent in normal" | 19795908 |
| CancerPDF_ID825 | KELDINTDGAVNF | Protein S100-A8 | Plasma | 718.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID826 | MLTELEKALNS | Protein S100-A8 | Plasma | 624.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID827 | VNPFRPGDSEPPPAPGAQRAQ | Zyxin | Plasma | 730.03 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID828 | SPVTPKFTPVAS | Zyxin | Plasma | 615.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID829 | TQPRGPPASSPAPAPKF | Zyxin | Plasma | 569.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID830 | SQAGMTGYGMPRQIL | Transgelin-2 | Plasma | 805.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID831 | SDNQLQEGKNVIGLQ | Transgelin-2 | Plasma | 821.92 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID832 | EEAGARVQQNVPSGTDTGDPQSKPLG | Apolipoprotein L1 | Plasma | 880.09 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID833 | VTEPISAESGEQVERVNEPSILEMS | Apolipoprotein L1 | Plasma | 910.77 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID834 | VTEPISAESGEQVER | Apolipoprotein L1 | Plasma | 815.89 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID835 | VNEPSILEMSR | Apolipoprotein L1 | Plasma | 637.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID836 | VNEPSILEMS | Apolipoprotein L1 | Plasma | 559.77 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID837 | YEGSYALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Plasma | 1121.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID838 | ALTSEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Plasma | 922.11 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID839 | SEEAERSDGDPVQPAVLQVHQTS | Serum deprivation-response protein | Plasma | 827.06 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID840 | GDPVQPAVLQVHQTS | Serum deprivation-response protein | Plasma | 788.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID841 | GDPVQPAVLQVHQ | Serum deprivation-response protein | Plasma | 694.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID842 | NEIPASVFVKQPVS | Serum deprivation-response protein | Plasma | 757.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID843 | KREEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 745.73 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID844 | KREEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 693.69 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID845 | REEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 703.04 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID846 | REEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 651 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID847 | EEAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 651.03 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID848 | EEAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 897.95 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID849 | EEAPSLRPAPPPISGGG | Fibrinogen beta chain | Plasma | 816.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID850 | EEAPSLRPAPPPISGG | Fibrinogen beta chain | Plasma | 787.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID851 | EEAPSLRPAPPPISG | Fibrinogen beta chain | Plasma | 759.39 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID852 | EEAPSLRPAPPPIS | Fibrinogen beta chain | Plasma | 730.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID853 | EAPSLRPAPPPISGGGYR | Fibrinogen beta chain | Plasma | 607.98 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID854 | EAPSLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 833.43 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID855 | EAPSLRPAPPPISGGG | Fibrinogen beta chain | Plasma | 751.89 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID856 | SLRPAPPPISGGGY | Fibrinogen beta chain | Plasma | 684.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID857 | SLRPAPPPISGGG | Fibrinogen beta chain | Plasma | 603.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID858 | PAPPPISGGGYR | Fibrinogen beta chain | Plasma | 584.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID859 | PAPPPISGGGY | Fibrinogen beta chain | Plasma | 506.75 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID860 | QGVNDNEEGFFSAR | Fibrinogen beta chain | Plasma | 785.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID861 | VNDNEEGFFSAR | Fibrinogen beta chain | Plasma | 692.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID862 | VNDNEEGFFSA | Fibrinogen beta chain | Plasma | 614.75 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID863 | NDNEEGFFSAR | Fibrinogen beta chain | Plasma | 643.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID864 | DNEEGFFSAR | Fibrinogen beta chain | Plasma | 586.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID865 | GPPVSELITK | Histone H1.4 | Plasma | 520.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID866 | SLVSKGTLVQT | Histone H1.4 | Plasma | 566.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID867 | AVFVDLEPTVIDEIR | Tubulin alpha-4A chain | Plasma | 858.46 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID868 | VFVDLEPTVIDEIR | Tubulin alpha-4A chain | Plasma | 822.94 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID869 | FVDLEPTVIDEIR | Tubulin alpha-4A chain | Plasma | 773.41 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID870 | VDLEPTVIDEIR | Tubulin alpha-4A chain | Plasma | 699.87 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID871 | DLEPTVIDEIR | Tubulin alpha-4A chain | Plasma | 650.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID872 | TIGKEIIDPVL | Tubulin alpha-4A chain | Plasma | 599.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID873 | TLEIPGNSDPNMIPDGDFNSYVR | Complement C4-A | Plasma | "1276.08, 851.05" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID874 | TLEIPGNSDPNMIPDGDFNSYV | Complement C4-B | Plasma | 1198.03 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID875 | TLEIPGNSDPNMIPDGDFNS | Complement C4-B | Plasma | 1066.97 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID876 | TLEIPGNSDPNMIPDGDFN | Complement C4-B | Plasma | 1023.45 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID877 | SDPNMIPDGDFNSYVR | Complement C4-B | Plasma | 913.9 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID878 | NGFKSHALQLNNRQI | Complement C4-B | Plasma | "870.46, 580.64" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID879 | NGFKSHALQLNN | Complement C4-B | Plasma | 671.84 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID880 | NGFKSHALQLN | Complement C4-B | Plasma | 614.82 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID881 | GFKSHALQLNNR | Complement C4-B | Plasma | 692.87 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID882 | SHALQLNNRQIR | Complement C4-B | Plasma | 725.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID883 | SHALQLNNRQI | Complement C4-B | Plasma | 647.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID884 | GLEEELQFSLGSKINVKVGGNS | Complement C4-B | Plasma | 769.07 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID885 | GLEEELQFSLGSKINV | Complement C4-B | Plasma | "881.96, 588.31" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID886 | GLEEELQFSLGSKI | Complement C4-B | Plasma | "775.41, 517.27" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID887 | GLEEELQFSLGSK | Complement C4-B | Plasma | "718.86, 479.57" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID888 | GLEEELQFSLGS | Complement C4-B | Plasma | 654.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID889 | LEEELQFSLGSK | Complement C4-B | Plasma | 690.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID890 | EEELQFSLGSKINV | Complement C4-B | Plasma | 796.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID891 | EELQFSLGSKINVK | Complement C4-B | Plasma | 796.43 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID892 | EELQFSLGSKINV | Complement C4-B | Plasma | 732.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID893 | EELQFSLGSKI | Complement C4-B | Plasma | 625.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID894 | EELQFSLGSK | Complement C4-B | Plasma | 569.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID895 | ELQFSLGSK | Complement C4-B | Plasma | 504.76 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID896 | DDPDAPLQPVTPLQLFEGR | Complement C4-B | Plasma | 1054.53 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID897 | DDPDAPLQPVTPLQLFEG | Complement C4-B | Plasma | 976.48 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID898 | DDPDAPLQPVTPLQL | Complement C4-B | Plasma | 809.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID899 | DDPDAPLQPVTPL | Complement C4-B | Plasma | 689.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID900 | DDPDAPLQPVTP | Complement C4-B | Plasma | 632.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID901 | DDPDAPLQPVTPLQLFEGRRN | Complement C4-B | Plasma | 793.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID902 | GLEEELQFSLGSKINVK | Complement C4-B | Plasma | 946.01 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID903 | SLGSKINVKVGGNS | Complement C4-B | Plasma | 680.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID904 | NGFKSHALQLNNRQIR | Complement C4-B | Plasma | 632.67 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID905 | NGFKSHALQLNNRQ | Complement C4-B | Plasma | 542.95 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID906 | NGFKSHALQLNNR | Complement C4-B | Plasma | 749.89 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID907 | NNALESKTAASGVE | PDZ and LIM domain protein 1 | Plasma | 695.84 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID908 | SEPQEVLHIGSA | PDZ and LIM domain protein 1 | Plasma | 633.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID909 | SEPQEVLHIG | PDZ and LIM domain protein 1 | Plasma | 554.78 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID910 | KTETQEKNPLPSKETIEQEKQAGES | Thymosin beta-4 | Plasma | 943.8 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID911 | TETQEKNPLPSKETIEQEKQAGES | Thymosin beta-4 | Plasma | 901.1 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID912 | TQEKNPLPSKETIEQE | Thymosin beta-4 | Plasma | 624.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID913 | KNPLPSKETIEQEKQAGES | Thymosin beta-4 | Plasma | 705.02 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID914 | NPLPSKETIEQEKQAGES | Thymosin beta-4 | Plasma | 662.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID915 | EEYPDRIMNSF | Tubulin beta-1 chain | Plasma | 700.81 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID916 | DLEPGTMDSIR | Tubulin beta-1 chain | Plasma | 617.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID917 | DSFVHGNSGAGNNW | Tubulin beta-1 chain | Plasma | 731.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID918 | SWVPHTFESELSDPVELLVAES | Alpha-1B-glycoprotein | Plasma | 1236.09 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID919 | TFESELSDPVELLVAES | Alpha-1B-glycoprotein | Plasma | 932.95 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID920 | FESELSDPVELLVAES | Alpha-1B-glycoprotein | Plasma | 882.42 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID921 | KRDRRLDDFQGTAGRKTRQRPS | hypothetical LOC727950 | Plasma | 882.14 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID922 | SASLPIQPH | hypothetical LOC727950 | Plasma | 475.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID923 | SSKITHRIHWESASLLR | Complement C3 | Plasma | 674.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID924 | SSKITHRIHWESASLL | Complement C3 | Plasma | 933.05 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID925 | SSKITHRIHWESA | Complement C3 | Plasma | 776.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID926 | SKITHRIHWESA | Complement C3 | Plasma | 732.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID927 | KITHRIHWESA | Complement C3 | Plasma | 689.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID928 | ITHRIHWESA | Complement C3 | Plasma | 625.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID929 | THRIHWESASLLR | Complement C3 | Plasma | 535.95 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID930 | THRIHWESASLL | Complement C3 | Plasma | 725.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID931 | THRIHWESASL | Complement C3 | Plasma | 668.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID932 | THRIHWESA | Complement C3 | Plasma | 568.78 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID933 | HRIHWESASLLR | Complement C3 | Plasma | 502.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID934 | HRIHWESASLL | Complement C3 | Plasma | 674.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID935 | HRIHWESASL | Complement C3 | Plasma | 618.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID936 | RIHWESASLLR | Complement C3 | Plasma | 456.58 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID937 | RIHWESASL | Complement C3 | Plasma | 549.78 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID938 | IHWESASLLR | Complement C3 | Plasma | 606.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID939 | IHWESASLL | Complement C3 | Plasma | 528.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID940 | IHWESASL | Complement C3 | Plasma | 471.73 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID941 | HWESASLLR | Complement C3 | Plasma | 549.78 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID942 | SEETKENEGFTVTAEGK | Complement C3 | Plasma | "928.42, 619.28" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID943 | SEETKENEGFTVTAEG | Complement C3 | Plasma | 864.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID944 | EETKENEGFTVTAEG | Complement C3 | Plasma | 820.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID945 | TKENEGFTVTAEGK | Complement C3 | Plasma | 755.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID946 | ENEGFTVTAEGK | Complement C3 | Plasma | 641.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID947 | NEGFTVTAEGK | Complement C3 | Plasma | 576.77 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID948 | TLDPERLGR | Complement C3 | Plasma | 528.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID949 | TLDPERLG | Complement C3 | Plasma | 450.73 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID950 | EGVQKEDIPPADLSDQVPDTESETR | Complement C3 | Plasma | 919.09 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID951 | EGVQKEDIPPADLS | Complement C3 | Plasma | 749.37 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID952 | LDVSLQLPSR | Complement C3 | Plasma | 564.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID953 | MVGGIAQIIAAQEE | Talin-1 | Plasma | 715.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID954 | VGGIAQIIAAQEEML | Talin-2 | Plasma | 771.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID955 | VGGIAQIIAAQEE | Talin-3 | Plasma | 649.84 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID956 | SGASGPENFQVG | Talin-4 | Plasma | 575.25 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID957 | MPPAQQQITSGQMH | Talin-5 | Plasma | 777.36 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |