ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
2629 | CGRKKRRQRAARRPPQ | VIII | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
2630 | CGRKKRAARQRAARAARPPQ | IX | 20 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
2631 | CGRKKRLLRQRRRPPQ | X | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
2632 | CGRKKRRQRRLLRPPQ | XI | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
2633 | CGRKKRRQRLLRRPPQ | XII | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
2634 | CGRKKRLLRQRLLRLLRPPQ | XIII | 20 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
2635 | CGRKKRRQRR-Ahx-RPPQ | XIV | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
2636 | CGRKKR-Ahx-RQRRRPPQ | XV | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
2637 | CGRKKRRQR-Ahx-RRPPQ | XVI | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
2638 | CGRKKR-Ahx-RQR-Ahx-R-ahx-RPPQ | XVII | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
2766 | YGRKKRRQRRR-acp-OH | Tat-OH | 12 | Modified | Linear | Synthetic | Cationic | Free | Free | acp, Epsilon-aminocaproic acid | Fluorophore (FITC) | 23085023 |
2771 | CKDEPQRRSARLSAKPAPPKPEPKPKKAPAKK | F3 Peptide | 32 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle | 23146434 |
2772 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Single-Chain Antibody) | 23160949 |
2773 | CALNN-YGRKKRRQRRR | Tat | 16 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle (Quantum dots) | 23184894 |
2774 | GIGKFLHSAKKFGKAFVGEIMNSGGKKWKMRRNQFWVKVQRG | MG2A | 42 | L | Linear | Synthetic | NA | Free | Free | NA | Peptide (Antmicrobial peptide MG2) | 23286306 |
2777 | RLLRLLRRLLRLLRRLLRC | PL | 19 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (siRNA loaded liposmes) | 23384441 |
2778 | RGDRGDRRDLRLDRGDLRC | PD1 | 19 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (siRNA loaded liposmes) | 23384441 |
2779 | RGDRLDRRDLRLDRRDLRC | PD2 | 19 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (siRNA loaded liposmes) | 23384441 |
2780 | RGERGERRELRLERGELRC | PE1 | 19 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (siRNA loaded liposmes) | 23384441 |
2781 | RGERLERRELRLERRELRC | PE2 | 19 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (siRNA loaded liposmes) | 23384441 |
2782 | VSRRRRRRGGRRRR | lowmolecular weight protamine (LMWP) | 14 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nucleic acid (miRNA) | 23478036 |
2785 | GGGRRRRRRYGRKKRRQRR | G3R6TAT | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Silver) | 23525222 |
2786 | rrrrrrrr | d-R8-C6-NP | 8 | D | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Couramin-6 loaded nanoparticle) | 23538098 |
2787 | RRRRRRRR | l-R8-C6-NP | 8 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Couramin-6 loaded nanoparticle) | 23538098 |
2788 | RRRRRRRR | L-R8-INS-NP | 8 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Insulin loaded nanoparticle) | 23538098 |
2789 | rrrrrrrr | d-R8-INS-NP | 8 | D | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Insulin loaded nanoparticle) | 23538098 |
2809 | GLPRRRRRRRRR | DSPE-PEG-CPP (CPP-Lp) | 12 | L | Linear | Synthetic | NA | Lipid Peg derivativtive | Free | NA | Nanoparticle (Liposomes) | 23680731 |
2810 | YKQCHKKGGKKGSG | NrTP1 | 14 | L | Linear | Synthetic | NA | Conjugation with rhodamine B | Free | NA | Fluorophore (Rhodamine B) | 23707662 |
2811 | YKQCHKKGG-Ahx-KKGSG | NrTP2 | 14 | Modified | Linear | Synthetic | NA | Conjugation with rhodamine B | Free | NA | Fluorophore (Rhodamine B) | 23707662 |
2812 | ykqchkkGGkkGsG | NrTP5 | 14 | Mix | Linear | Synthetic | NA | Conjugation with rhodamine B | Free | NA | Fluorophore (Rhodamine B) | 23707662 |
2813 | YKQSHKKGGKKGSG | NrTP6 | 14 | L | Linear | Synthetic | NA | Conjugation with rhodamine B | Free | NA | Fluorophore (Rhodamine B) | 23707662 |
2814 | YRQSHRRGGRRGSG | NrTP7 | 14 | L | Linear | Synthetic | NA | Conjugation with rhodamine B | Free | NA | Fluorophore (Rhodamine B) | 23707662 |
2815 | WKQSHKKGGKKGSG | NrTP8 | 14 | L | Linear | Synthetic | NA | Conjugation with rhodamine B | Free | NA | Fluorophore (Rhodamine B) | 23707662 |
2816 | GRKKRRQRRRPPQ | Tat (48-60) | 13 | L | Linear | Protein derived | Cationic | Conjugation with rhodamine B | Free | NA | Fluorophore (Rhodamine B) | 23707662 |
2817 | GRKKRRQRRRPPQRKC | Tat | 16 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein [synthetic salmon CT (sCT)] | 23802147 |
2818 | GRKKRRERRRPPERKCX | Tat | 17 | L | Linear | Protein derived | Cationic | Free | Free | NA | Peptide [VP1 BC loop (V) peptides] | 23802147 |
2819 | VGAlAvVvWlWlWlWbA-GSG-PKKKRKVC | artifcial CPP | 28 | Mix | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) and Nanoparticles [single wall carbon nanotube (SWCNT)] | 23812036 |
2820 | EARPALLTSRLRFIPK | GV1001 | 16 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23827187 |
2821 | VSRRRRRRGGRRRR | low molecular weight protamine (LMWP) | 14 | L | Linear | Chimeric | Cationic | Sulfhydrylation | Free | Sulfhydrylation | Protein (Insulin-PEG-LMWP) | 23863452 |
2824 | TPWWRLWTKWHHKRRDLPRKPEGC | FITC-Rath | 24 | L | Linear | Protein derived | NA | NA | Free | NA | Fluorophore (FITC) | 23937069 |
2825 | TPWWRLWTKWHHKRRDLPRKPEGC | Rath-FITC | 24 | L | Linear | Protein derived | NA | NA | Free | NA | Fluorophore (FITC) | 23937069 |
2828 | MIIYRDLISH | TCTPPTD | 10 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23256924 |
2829 | YSSYSAPVSSSLSVRRSYSSSSGS | NFL-TBS.40-63 | 24 | L | Linear | Protein derived | NA | Free | Free | Biotinylation | Fluorophore (FITC) | 23603097 |
2830 | GRKKRRQRRRPPQ | Tat.48-60 | 13 | L | Linear | Protein derived | Cationic | Free | Free | Biotinylation | Fluorophore (FITC) | 23603097 |
2844 | KHHWHHVRLPPPVRLPPPGNHHHHHH | MMD45 | 26 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (Quantum dots) | 23732866 |
2845 | KKWALLALALHHLAHLALHLALALKKAHHHHHH | MMD47 | 33 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (Quantum dots) | 23732866 |
2846 | RKKRRRESWVHLPPPVHLPPPGGHHHHHH | MMD49 | 29 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (Quantum dots) | 23732866 |
2847 | Me-RKKRRRESWVHLPPPVHLPPPGGHHHHHH | MMD68 | 29 | Modified | Linear | Synthetic | NA | Free | Free | Me, methyl group | Nanoparticle (Quantum dots) | 23732866 |
2848 | RRRRRRRRRGGLAA(Aib)SGWKHHHHHH | JB434 | 25 | Modified | Linear | Synthetic | NA | Free | Free | Aib, α-amino isobutyric acid | Nanoparticle (Quantum dots) | 23732866 |
2853 | KKALLAHALHLLALLALHLAHALKKA | LAH4-L1 | 26 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA and siRNA) | 22138072 |