Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 948| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2433 | LKKLLKLLKKLLKLAG | LK-1 | 16 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (FITC) | 25056130 |
| 2434 | LKKLCKLLKKLCKLAG | LK-2 | 16 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (FITC) | 25056130 |
| 2435 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (FITC) | 25056130 |
| 2436 | VTPHHVLVDEYTGEWVDSQFK | VG-21 | 21 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25154664 |
| 2437 | RRRRWWWW | [R4W4]Cyclic | 8 | L | Cyclic | Synthetic | Positive charge and hydrophobic moiety, amphiphilic | Conjugation with fluorescein | Cyclization | NA | Fluorophore (Fluorescein) | 25157458 |
| 2443 | HEHEHEHEHE-PEG-PLA | HEO | 10 | L | Linear | Synthetic | Cationic | Free | Conjugation with PEG-PLA | NA | Fluorophore (Coumarin-6) and small molecule drug (Docetaxel) | 24614579 |
| 2444 | RGRGRGRGRG-PEG-PLA | RGO | 10 | L | Linear | Synthetic | Cationic | Free | Conjugation with PEG-PLA | NA | Fluorophore (Coumarin-6) and small molecule drug (Docetaxel) | 24614579 |
| 2445 | mPEG-PLA-HEHEHEHEHE | HEI | 10 | L | Linear | Synthetic | Cationic | Conjugated with PEG-PLA | Free | NA | Fluorophore (Coumarin-6) and small molecule drug (Docetaxel) | 24614579 |
| 2446 | mPEG-PLA-RGRGRGRGRG | RGI | 10 | L | Linear | Synthetic | Cationic | Conjugated with PEG-PLA | Free | NA | Fluorophore (Coumarin-6) and small molecule drug (Docetaxel) | 24614579 |
| 2448 | YGRKKRRQRRR | SP-TatCherry | 11 | L | Linear | Synthetic | Amphipathic | Coupled to signal peptide | Conjugation with mCherry | NA | Fluorophore (mCherry) | 24928321 |
| 2449 | YGRKKRRQRRRYGRKKRRQRRRYGRKKRRQRRR | SP-Tatm3xCherry | 33 | L | Linear | Synthetic | Amphipathic | Coupled to signal peptide | Conjugation with mCherry | NA | Fluorophore (mCherry) | 24928321 |
| 2452 | GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD | MCoTI-II | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2453 | GGVCPKILKKCRRDSDCPGACICRGNGWCGSGSD | MCoTI-M1 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2454 | GGVCPKILRRCRRDSDCPGACICRGNGYCGSGSD | MCoTI-M2 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2455 | GGVCPKILRRCRRDSDCPGACICRGNGWCGSGSD | MCoTI-M3 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2456 | GGVCPKILRRCRRDSDCPGACICRGNGYCGSGSR | MCoTI-M4 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2457 | GGVCPRILRRCRRDSDCPGACICRGNGYCGSGSK | MCoTI-M5 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2458 | GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD | MCoTI-M6 | 34 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2459 | GRCTKSIPPICFPD | SFTI-1 | 14 | L | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2460 | grctksippicfpd | D-SFTI-1 | 14 | D | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2461 | GACTKSIPPICFPD | SFTI-M1 | 14 | L | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2462 | GRCTKSIPPICFPA | SFTI-M2 | 14 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2463 | GRCTKSIPPICWPD | SFTI-M3 | 14 | L | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2464 | GRCTKSIPPICWPK | SFTI-M4 | 14 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2465 | GRCTRSIPPKCWPD | SFTI-M5 | 14 | L | Cyclic | Synthetic | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2466 | GRXTKSIPPIXFPD | SFTI-M6 | 14 | Modified | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | X, α-aminobutyric acid | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2467 | GRXTKSIPPIXFPD | SFTI-M7 | 14 | Modified | Cyclic | Synthetic | NA | Conjugation with Alexa Flour 488 | Free | X, α-aminobutyric acid | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2468 | YGRKKRRQRRRPPQG | TAT | 15 | L | Linear | Protein derived | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2471 | HSDAVFTDNYTALRKQMAVKKYLNSILNYGRKKRRQRRR | VIP-TAT | 39 | L | Linear | Protein derived | Cationic | Conjugated with VIP | Free | NA | Fluorophore (FITC) | 25086267 |
| 2482 | RXRRXRRXRRXR | Peptide I | 12 | Modified | Linear | Synthetic | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | X, aeLP, aminoethylpropyl | Fluorophore (5/6-carboxyfluorescein) | 25096299 |
| 2483 | RXRRXRRXRRXR | Peptide II | 12 | Modified | Linear | Synthetic | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | X, aeDP, aminoethylpropyl | Fluorophore (5/6-carboxyfluorescein) | 25096299 |
| 2484 | RXRRXRRXRRXR | Peptide III | 12 | Modified | Linear | Synthetic | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | X, apLP, aminopropylpropyl | Fluorophore (5/6-carboxyfluorescein) | 25096299 |
| 2485 | RXRRXRRXRRXR | Peptide IV | 12 | Modified | Linear | Synthetic | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | X, apDP, aminopropylpropyl | Fluorophore (5/6-carboxyfluorescein) | 25096299 |
| 2486 | RXRRXRRXRRXR | Peptide V | 12 | Modified | Linear | Synthetic | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | X, 6-aminohexanoic acid (Ahx) | Fluorophore (5/6-carboxyfluorescein) | 25096299 |
| 2491 | CGYGRKKRRQRRRGC | Tat | 15 | L | Linear | Protein derived | Cationic | Free | Free | NA | Ultrasound contrast agent (UCA), Fluorophore (FITC) | 24985759 |
| 2492 | GWTLNSAGYLLGKINLKALAALAKKIL | Transportan | 27 | Modified | Linear | Synthetic | Amphipathic | Free | Amidation | Fluorescein coupled to Lys13 | Fluorophore (Fluorescein) | 25016968 |
| 2493 | KLALKLALKALKAALKLA | MAP | 18 | L | Linear | Synthetic | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2494 | GRKKRRQRRRPPQ | pTat | 13 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2495 | RQIKIWFQNRRMKWKK | pAntp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2496 | RRRRRRRRR | Arg9 | 9 | L | Linear | Synthetic | Cationic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2497 | AGYLLGKINLKALAALAKKIL | TP10 | 21 | Modified | Linear | Chimeric | Amphipathic | Free | Amidation | Oregon Green 488 coupled to Lys7 | Fluorophore (Fluorescein) | 25016968 |
| 2502 | CARSKNKDC | CAR | 9 | L | Linear | Synthetic | NA | Free | Conjugation with micelles with green fluorescent 5-carboxyfluorescein | NA | Fluorophore (5-carboxyfluorescein), Nanoparticle (fasudi loaded micelles) | 25266507 |
| 2507 | MGVADLIKKFESISKEEGGGGK(Ahx-FITC)-GGrRrRrRRR | probe1 | 32 | Mix | Linear | Synthetic | NA | Conjugated to recognition unit via Ahx-FITC-GG | Free | NA | Fluorophore (FITC) | 25410769 |
| 2508 | MGVADLIKKFESISKEEGGGGK(RhB)GGrRrRrRRR | probe2 | 32 | Mix | Linear | Synthetic | NA | Conjugated to recognition unit via Rhb-GG | Free | NA | Fluorophore (rhodamine B) | 25410769 |
| 2509 | MGVADLIKKFESISKEEGGGGK(PA-RhB)GGrRrRrRRR | probe3 | 32 | Mix | Linear | Synthetic | NA | Conjugated to recognition unit via PA-Rhb-GG | Free | NA | Fluorophore (photo-activatable rhodamine B) | 25410769 |
| 2514 | RKKRRQRRRRKKRRQRRR | Tat2-Nat | 18 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Conjugation with natamycin | NA | Small molecule drug (Natamycin), Fluorophore (FITC) | 25467959 |
| 2515 | AKKRRQRRRAKKRRQRRR | MTat2-Nat | 18 | L | Linear | Synthetic | Cationic | Conjugation with FITC | Conjugation with natamycin | NA | Small molecule drug (Natamycin), Fluorophore (FITC) | 25467959 |
| 2539 | HHHRRRRRRRR | 5-FAM-H3R8 | 11 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (5-FAM) | 25547808 |
| 2540 | HHHRRRRRRRR | MTS-(5-FAM)- H3R8 | 11 | L | Linear | Synthetic | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Free | NA | Fluorophore (5-FAM) and MTS | 25547808 |
| 2543 | YGRKKRRQRRR | CF-TAT-substrate | 11 | L | Linear | Protein derived | NA | Conjugation with 5(6)-carboxyfluorescein N-hydroxysuccinimidyl ester | Conjugation with substrate | NA | Fluorophore (Fluorescein), substrate | 23621550 |