Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 948| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2544 | YGRKKRRQRRR | Ac-TAT-substrate | 11 | L | Linear | Protein derived | NA | Acetylation | Conjugation with substrate | NA | Fluorophore (Fluorescein), substrate | 23621550 |
| 2545 | KKWKMRRNQFWIKIQR | CF-Penetratin-substrate | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugation with 5(6)-Carboxyfluorescein | Conjugation with substrate | NA | Fluorophore (Fluorescein), substrate | 23621550 |
| 2546 | KKWKMRRNQFWIKIQR | Ac-Penetratin-substrate | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Conjugation with substrate | NA | Fluorophore (Fluorescein), substrate | 23621550 |
| 2554 | RRRRRRRRR | FITC-ST2-104 | 9 | L | Linear | Synthetic | Cationic | Conjugation with FITC | Conjugation with CBD3 peptide of CRMP2 | NA | Peptide [Ca2+ channel binding domain 9CBD3)] and Fluorophore (FITC) | 23106100 |
| 2577 | RGGRLSYSRRRFSTSTGR | Synb1-ELP | 18 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (Rhodamine) | 24903464 |
| 2580 | CKYGRKKRRQRRR | fTAT | 13 | L | Linear | Protein derived | Cationic | Extra Cys and Lys added for labeling of TMR | Free | NA | Fluorophore (TMR) | 24930129 |
| 2581 | RRRQRRKKRGYCKCKYGRKKRRQRRR | dfTAT | 26 | L | Linear | Protein derived | Cationic | Extra Cys and Lys added for labeling of TMR and dimerization | Free | NA | Protein (eGFP), Fluorophore (TMR) | 24930129 |
| 2582 | CKYGRKKRRQRRR | acFTAT | 13 | L | Linear | Protein derived | Cationic | Acetamidation | Free | NA | Fluorophore (TMR) | 24930129 |
| 2583 | RRRQRRKKRGYCKCKYGRKKRRQRRR | nrdfTAT | 26 | L | Linear | Protein derived | Cationic | bis(maleimido)ethane added | Free | NA | Fluorophore (TMR) | 24930129 |
| 2595 | KIAKLKAKIQKLKQKIAKLK | fGeT | 20 | L | Linear | Synthetic | NA | Conjugation with 5(6)-Carboxyfluorescein | Free | NA | Fluorophore (Carboxyflouresein) | 24657280 |
| 2596 | YGRKKRRQRRR | fTat | 11 | L | Linear | Protein derived | Cationic | Conjugation with 5(6)-Carboxyfluorescein | Free | NA | Fluorophore (Carboxyflouresein) | 24657280 |
| 2598 | IPLVVPLRRRRRRRRC | RIPL peptide | 16 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (Liposomes), Fluorophore (FITC) | 24704199 |
| 2599 | GGAYVTRSSAVRLRSSVPGVRLLQ | CF-Vim-TBS.58-81 | 24 | L | Linear | Protein derived | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Carboxyfluorescein) | 21575694 |
| 2600 | GRKKRRQRRRPPQ | CF-Tat.48-60 | 13 | L | Linear | Protein derived | NA | Conjugation with 5(6)-Carboxyfluorescein | Amidation | NA | Fluorophore (Carboxyfluorescein) | 21575694 |
| 2601 | GLRKRLRKFRNKIKEK | CF-sC18 | 16 | L | Linear | Synthetic | NA | Amidation | NA | NA | Fluorophore (Carboxyfluorescein) | 21956822 |
| 2602 | B-GLRK(NIA)RLRKFRNKIKEK | CF-sC18(NIA) | 17 | Modified | Linear | Synthetic | NA | Amidation | NA | B, Beta-Alanine; NIA, 2-(2-nitroimidazol-1-yl)acetic acid | Fluorophore (Carboxyfluorescein) | 21956822 |
| 2619 | MAMPGEPRRANVMAHKLEPASLQLR NSCA | CPPK | 29 | L | Linear | Synthetic | NA | Conjugation with FITC | NA | NA | Fluorophore (FITC) | 22076844 |
| 2620 | MAPQRDTVGGRTTPPSWGPAKAQLRNSCA | CPPL | 29 | L | Linear | Synthetic | NA | Conjugation with FITC | NA | NA | Fluorophore (FITC) | 22076844 |
| 2621 | RRRRRRRRRRR | R11 | 11 | L | Linear | Synthetic | Cationic | Conjugation with FITC | NA | NA | Fluorophore (FITC) | 22076844 |
| 2622 | CGRKKRRQRRRPPQ | Tat | 14 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2623 | CGRKKRWWRQRRRPPQ | II | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2624 | CGRKKRRQRRWWRPPQ | III | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2625 | CGRKKRRQRWWRRPPQ | IV | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2626 | CGRKKRWWRQRWWRWWRPPQ | V | 20 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2627 | CGRKKRAARQRRRPPQ | VI | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2628 | CGRKKRRQRRAARPPQ | VII | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2629 | CGRKKRRQRAARRPPQ | VIII | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2630 | CGRKKRAARQRAARAARPPQ | IX | 20 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2631 | CGRKKRLLRQRRRPPQ | X | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2632 | CGRKKRRQRRLLRPPQ | XI | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2633 | CGRKKRRQRLLRRPPQ | XII | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2634 | CGRKKRLLRQRLLRLLRPPQ | XIII | 20 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Fluorescein) | 22100438 |
| 2635 | CGRKKRRQRR-Ahx-RPPQ | XIV | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
| 2636 | CGRKKR-Ahx-RQRRRPPQ | XV | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
| 2637 | CGRKKRRQR-Ahx-RRPPQ | XVI | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
| 2638 | CGRKKR-Ahx-RQR-Ahx-R-ahx-RPPQ | XVII | 14 | L | Linear | Synthetic | Cationic | Free | Free | X, 6-aminohexanoic acid (Ahx) | Fluorophore (Fluorescein) | 22100438 |
| 2639 | YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG | Crotamine | 42 | L | Linear | Protein derived | NA | NA | NA | NA | Fluorophore (Alexa 700) | 22142367 |
| 2640 | INLKALAALAKKIL | TAM-MP | 14 | L | Linear | Synthetic | NA | Conjugation with 6-carboxytetramethyl rhodamine | NA | NA | Fluorophore (TAMRA) | 22148546 |
| 2641 | inlkalaalakkil | TAM-iMP | 14 | D | Linear | Synthetic | NA | Conjugation with 6-carboxytetramethyl rhodamine | NA | NA | Fluorophore (TAMRA) | 22148546 |
| 2642 | LIKKALAALAKLNI | TAM-rMP | 14 | L | Linear | Synthetic | NA | Conjugation with 6-carboxytetramethyl rhodamine | NA | NA | Fluorophore (TAMRA) | 22148546 |
| 2643 | likkalaalaklni | TAM-riMP | 14 | D | Linear | Synthetic | NA | Conjugation with 6-carboxytetramethyl rhodamine | NA | NA | Fluorophore (TAMRA) | 22148546 |
| 2644 | INLKKLAKL(Aib)KKIL | TAM-MitP | 14 | Modified | Linear | Synthetic | NA | Conjugation with 6-carboxytetramethyl rhodamine | NA | Aib, α-amino isobutyric acid | Fluorophore (TAMRA) | 22148546 |
| 2645 | inlkklakl(Aib)kkil | TAM-iMitP | 14 | Modified | Linear | Synthetic | NA | Conjugation with 6-carboxytetramethyl rhodamine | NA | Aib, α-amino isobutyric acid | Fluorophore (TAMRA) | 22148546 |
| 2646 | LIKK(Aib)LKALKKLNI | TAM-rMitP | 14 | Modified | Linear | Synthetic | NA | Conjugation with 6-carboxytetramethyl rhodamine | NA | Aib, α-amino isobutyric acid | Fluorophore (TAMRA) | 22148546 |
| 2647 | likk(Aib)lkalkklni | TAM-riMitP | 14 | Modified | Linear | Synthetic | NA | Conjugation with 6-carboxytetramethyl rhodamine | NA | Aib, α-amino isobutyric acid | Fluorophore (TAMRA) | 22148546 |
| 2654 | FXrFXrFXr | (Fxr)3 | 9 | Modified | Linear | Synthetic | Cationic | NA | NA | Fx, cyclohexylalanine | Fluorophore (Fluorescein) | 22238158 |
| 2655 | FXrFXrFXrFXr | (Fxr)4 | 12 | Modified | Linear | Synthetic | Cationic | NA | NA | Fx, cyclohexylalanine | Fluorophore (Fluorescein) | 22238158 |
| 2656 | FXrFXrFXrFXrFXr | (Fxr)5 | 15 | Modified | Linear | Synthetic | Cationic | NA | NA | Fx, cyclohexylalanine | Fluorophore (Fluorescein) | 22238158 |
| 2657 | FXrFXrFXrFXrFXrFXr | (Fxr)6 | 18 | Modified | Linear | Synthetic | Cationic | NA | NA | Fx, cyclohexylalanine | Fluorophore (Fluorescein) | 22238158 |
| 2666 | GRKKRRQRRRPPQC | TAT | 14 | L | Linear | Synthetic | Cationic and amphipathic | NA | Amidation | NA | Fluorophore (Alexa660) | 22285548 |