Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 391| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2222 | RQIKIWFQNRRMKWKK | EGFP-Antp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2223 | DAATARGRGRSAASRPTERPRAPARSASRPRRPVD | EGFP-VP_22 | 35 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2224 | LLIILRRRIRKQAHAHSK | EGFP-pVEC | 18 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2226 | LGTYTQDFNKFHTFPQTAIGVGAP | EGFP-hcT(9-32) | 24 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2227 | KETWWETWWTEWSQPKKKRKV | EGFP-Pep-1 | 21 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2228 | GALFLGWLGAAGSTMGAPKKKRKV | EGFP-MPG | 24 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2229 | GLFRALLRLLRSLWRLLLRA | EGFP-ppTG20 | 20 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2231 | KKALLALALHHLAHLALHLALALKKA | EGFP-LAH4 | 26 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2233 | CRQIKIWFQNRRMKWKK | Penetratin | 17 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
| 2234 | CRQIKIWFQNRRMKWKKKLAKLAKKLAKLAK | KLA-Pen | 31 | L | Linear | Chimeric | Amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
| 2235 | CRRLRHLRHHYRRRWHRFRC | Mgpe-9 | 20 | L | Linear | Synthetic | Secondary Amphipathic | Free | Free | Addition of cysteine in Mgpe3 sequence makes Mgpe9 | Nucleic acid (Plasmid DNA) | 24816284 |
| 2236 | CLLYWFRRRHRHHRRRHRRC | Mgpe-10 | 20 | L | Linear | Synthetic | Primary Amphipathic | Free | Free | Addition of cysteine in Mgpe4 sequence makes Mgpe10 | Nucleic acid (Plasmid DNA) | 24816284 |
| 2237 | RRLRHLRHHYRRRWHRFR | Mgpe-3 | 18 | L | Linear | Synthetic | Secondary Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 24816284 |
| 2238 | LLYWFRRRHRHHRRRHRR | Mgpe-4 | 18 | L | Linear | Synthetic | Primary Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 24816284 |
| 2240 | Cyclo (FΦRRRRQ) | cFΦR4-Rho | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine | Fluorophore (Rhodamine), Protein (GFP) | 24896852 |
| 2241 | Cyclo (FΦRRRRQ) | cFΦR4-Dex | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine | Dexamethasone | 24896852 |
| 2243 | Cyclo(FΦRRRRQ) | cFΦR4-FITC | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine | Fluorophore (FITC) | 24896852 |
| 2244 | Cyclo (FΦRRRRQ) | cFΦR4-R5 | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine | Peptide (RRRRR) | 24896852 |
| 2245 | Cyclo (FΦRRRRQ) | cFΦR4-A5 | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine | Peptide (AAAAA) | 24896852 |
| 2246 | Cyclo (FΦRRRRQ) | cFΦR4-F4 | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine | Peptide (FFFF) | 24896852 |
| 2247 | Cyclo (FΦRRRRQ) | cFΦR4-PCP | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2250 | RQIKIWFQNRRMKWKK | Antp-PCP | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2251 | Cyclo (FΦRRRRQ) | bicyclo(FΦR4-A5)Rho | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine, J, l-2,3-diaminopropionic acid, Tm, trimesoyl | Cyclic peptide (Tm(AAAAA)) | 24896852 |
| 2252 | Cyclo (FΦRRRRQ) | bicyclo(FΦR4-A7)Rho | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine, J, l-2,3-diaminopropionic acid, Tm, trimesoyl | Cyclic peptide Tm(AAAAAAA)K | 24896852 |
| 2253 | Cyclo (FΦRRRRQ) | bicyclo(FΦR4-RARAR)Rho | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine, J, l-2,3-diaminopropionic acid, Tm, trimesoyl | Cyclic peptide Tm(RARAR)K | 24896852 |
| 2254 | Cyclo (FΦRRRRQ) | bicyclo(FΦR4-DADAD)Rho | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine, J, l-2,3-diaminopropionic acid, Tm, trimesoyl | Cyclic peptide Tm(DADAD)K | 24896852 |
| 2255 | Cyclo (FΦRRRRQ) | monocyclo(FΦR4-A5)Rho | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine | Peptide AAAAA | 24896852 |
| 2256 | Cyclo (FΦRRRRQ) | monocyclo(FΦR4-A7)Rho | 8 | Modified | Cyclic | Synthetic | Amphipathic | Free | Amidation | Φ, L-2-naphthylalanine | Peptide AAAAAAA | 24896852 |
| 2289 | AGYLLGKINLKALAALAKKIL | Transportan 10 | 21 | L | Linear | Chimeric | Amphipathic | Conjugation with 5(6)-Carboxyfluorescein | Free | NA | Fluorophore (Carboxyfluorescein) | 24937132 |
| 2294 | RQIKIWFQNRRMKWKK | F(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2295 | RQIKIWFQNRRMKWKK | G(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2296 | AGYLLGKINLKALAALAKKIL | F(SG)4TP10 | 21 | L | Linear | Protein derived | Amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2297 | AGYLLGKINLKALAALAKKIL | G(SG)4TP10 | 21 | L | Linear | Protein derived | Amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
| 2312 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Peptide (Mitochondrial Target Domain of NOXA) | 24416126 |
| 2319 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Biotinylation | Amidation | NA | Biotin-gly4 | 25112713 |
| 2322 | RKKRRQRRRGGGKLLKLLLKLLLKLLK | TatLK15 | 27 | L | Linear | Chimeric | Cationic and Amphipathic | Free | Amidation | NA | Fluorophore (TAMRA) | 24218116 |
| 2331 | RQIKIWFQNRRMKWKKC | Pen-C-Cy5 | 17 | L | Linear | Protein derived | Cationic and amphipathic | Free | Cysteine addition | NA | Fluorophore (Cy5) | 24276021 |
| 2342 | RQIKIWFQNRRMKWKKK | Penetratin | 17 | L | Linear | Protein derived | Cationic and amphipathic | Conjugation with 5-carboxyfluorescein via a lysine residue | Free | NA | Fluorophore [5-carboxyfluorescein (FAM)] | 24521351 |
| 2408 | GLKKLARLFHKLLKLGC | RF | 17 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 24867193 |
| 2409 | GLKKLAELFHKLLKLGC | EF | 17 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 24867193 |
| 2410 | GLKKLARLAHKLLKLGC | RA | 17 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 24867193 |
| 2411 | GLKKLAELAHKLLKLGC | EA | 17 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 24867193 |
| 2419 | AGYLLGKINLKALAALAKKIL | TP10 | 21 | L | Linear | Chimeric | Amphipathic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2428 | LLIILRRRIRKQAHAHSK | pVEC | 18 | L | Linear | Protein derived | Amphipathic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2438 | AGYLLGKINLKALAALAKKIL | PF3 | 21 | L | Linear | Synthetic | Amphipathic | Stearylation | Conjugation with FAM to ε-NH2 group of additional lysine | NA | Nucleic acid (pGL3, siRNA, SCO) | 25135660 |
| 2439 | AGYLLGKTNLKALAALAKKIL | NF1 | 21 | L | Linear | Synthetic | Amphipathic | Stearylation | Conjugation with FAM to ε-NH2 group of additional lysine | NA | Nucleic acid (pGL3, siRNA, SCO) | 25135660 |
| 2440 | AGYLLG)δ-OINLKALAALAKKIL | NF51 | 21 | Modified | Linear | Synthetic | Amphipathic | Stearylation | Conjugation with FAM to ε-NH2 group of additional lysine | O, Ornithine | Nucleic acid (pGL3, siRNA, SCO) | 25135660 |
| 2448 | YGRKKRRQRRR | SP-TatCherry | 11 | L | Linear | Synthetic | Amphipathic | Coupled to signal peptide | Conjugation with mCherry | NA | Fluorophore (mCherry) | 24928321 |
| 2449 | YGRKKRRQRRRYGRKKRRQRRRYGRKKRRQRRR | SP-Tatm3xCherry | 33 | L | Linear | Synthetic | Amphipathic | Coupled to signal peptide | Conjugation with mCherry | NA | Fluorophore (mCherry) | 24928321 |
| 2450 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |