Amino Acid CompositionAmino AcidACDEFGHIKLMNPQRSTVWY012345678910111213141516Amino Acid % Composition of Peptide Export to raster or vector imagePrint the chart

Hydrophobicity("JURD980101")HydrophobicityALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL0-7.5-5-2.52.55Hydrophobicity Export to raster or vector imagePrint the chart

Preference for beta-strandsPreference for beta-strandsALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL00.511.52Preference for beta-strands Export to raster or vector imagePrint the chart

Frequency of alpha-helix in alpha/beta classFrequency of alpha-helixALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL00.250.50.7511.251.51.75Frequency of alpha-helix in alpha/beta class Export to raster or vector imagePrint the chart


Amino Acid Polarity Hydrophobic Hydrophilic
22(66 %) 11 (34 %)

Amino Acid Charge+vely charged-vely chargedNeutral Amino acid
1(3 %)2(6 %)30 (91 %)

Amino Acid Surface exposureSurface exposedBurried
17(51 %)16 (49 %)

DisorderDisorder-promotingOrder-promotingDisorder-order neutral
10(34 %)19(57 %)4 (9 %)

FlexibilityHighly flexibilityLow flexibility
9(27 %)24 (73 %)


Charge
ALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL
P+veN-veO No chargeN
Polarity
ALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL
PHydrophobicNhydrophilic



Numerical values of physicochemical properties are based on AAindex database (Kawashima et al. 2008)