Amino Acid CompositionAmino AcidACDEFGHIKLMNPQRSTVWY024681012141618Amino Acid % Composition of Peptide Export to raster or vector imagePrint the chart

Hydrophobicity("JURD980101")HydrophobicityENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST-6-4-20246Hydrophobicity Export to raster or vector imagePrint the chart

Preference for beta-strandsPreference for beta-strandsENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST00.511.52Preference for beta-strands Export to raster or vector imagePrint the chart

Frequency of alpha-helix in alpha/beta classFrequency of alpha-helixENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST00.250.50.7511.251.51.75Frequency of alpha-helix in alpha/beta class Export to raster or vector imagePrint the chart


Amino Acid Polarity Hydrophobic Hydrophilic
12(34 %) 23 (66 %)

Amino Acid Charge+vely charged-vely chargedNeutral Amino acid
6(17 %)5(14 %)24 (69 %)

Amino Acid Surface exposureSurface exposedBurried
22(62 %)13 (38 %)

DisorderDisorder-promotingOrder-promotingDisorder-order neutral
16(55 %)13(37 %)6 (8 %)

FlexibilityHighly flexibilityLow flexibility
18(51 %)17 (49 %)


Charge
ENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST
P+veN-veO No chargeN
Polarity
ENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQST
PHydrophobicNhydrophilic



Numerical values of physicochemical properties are based on AAindex database (Kawashima et al. 2008)