Amino Acid CompositionAmino AcidACDEFGHIKLMNPQRSTVWY0123456789101112131415Amino Acid % Composition of Peptide Export to raster or vector imagePrint the chart

Hydrophobicity("JURD980101")HydrophobicityINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKS0-7.5-5-2.52.55Hydrophobicity Export to raster or vector imagePrint the chart

Preference for beta-strandsPreference for beta-strandsINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKS00.511.52Preference for beta-strands Export to raster or vector imagePrint the chart

Frequency of alpha-helix in alpha/beta classFrequency of alpha-helixINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKS00.250.50.7511.251.51.75Frequency of alpha-helix in alpha/beta class Export to raster or vector imagePrint the chart


Amino Acid Polarity Hydrophobic Hydrophilic
17(48 %) 18 (52 %)

Amino Acid Charge+vely charged-vely chargedNeutral Amino acid
3(8 %)5(14 %)27 (78 %)

Amino Acid Surface exposureSurface exposedBurried
21(60 %)14 (40 %)

DisorderDisorder-promotingOrder-promotingDisorder-order neutral
16(50 %)16(45 %)3 (5 %)

FlexibilityHighly flexibilityLow flexibility
20(57 %)15 (43 %)


Charge
INFYDPLVFPSDEFDASISQVNEKINQSLAFIRKS
P+veN-veO No chargeN
Polarity
INFYDPLVFPSDEFDASISQVNEKINQSLAFIRKS
PHydrophobicNhydrophilic



Numerical values of physicochemical properties are based on AAindex database (Kawashima et al. 2008)