Amino Acid CompositionAmino AcidACDEFGHIKLMNPQRSTVWY024681012141618Amino Acid % Composition of Peptide Export to raster or vector imagePrint the chart

Hydrophobicity("JURD980101")HydrophobicityKPNNDFHFEVFNFVPCSICSNNPTCWAICKRI0-7.5-5-2.52.55Hydrophobicity Export to raster or vector imagePrint the chart

Preference for beta-strandsPreference for beta-strandsKPNNDFHFEVFNFVPCSICSNNPTCWAICKRI00.511.52Preference for beta-strands Export to raster or vector imagePrint the chart

Frequency of alpha-helix in alpha/beta classFrequency of alpha-helixKPNNDFHFEVFNFVPCSICSNNPTCWAICKRI00.250.50.7511.251.5Frequency of alpha-helix in alpha/beta class Export to raster or vector imagePrint the chart


Amino Acid Polarity Hydrophobic Hydrophilic
14(43 %) 18 (57 %)

Amino Acid Charge+vely charged-vely chargedNeutral Amino acid
4(12 %)2(6 %)26 (82 %)

Amino Acid Surface exposureSurface exposedBurried
17(53 %)15 (47 %)

DisorderDisorder-promotingOrder-promotingDisorder-order neutral
10(34 %)19(59 %)3 (7 %)

FlexibilityHighly flexibilityLow flexibility
15(46 %)17 (54 %)


Charge
KPNNDFHFEVFNFVPCSICSNNPTCWAICKRI
P+veN-veO No chargeN
Polarity
KPNNDFHFEVFNFVPCSICSNNPTCWAICKRI
PHydrophobicNhydrophilic



Numerical values of physicochemical properties are based on AAindex database (Kawashima et al. 2008)