Amino Acid CompositionAmino AcidACDEFGHIKLMNPQRSTVWY024681012141618Amino Acid % Composition of Peptide Export to raster or vector imagePrint the chart

Hydrophobicity("JURD980101")HydrophobicityKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKK0-7.5-5-2.52.55Hydrophobicity Export to raster or vector imagePrint the chart

Preference for beta-strandsPreference for beta-strandsKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKK00.511.52Preference for beta-strands Export to raster or vector imagePrint the chart

Frequency of alpha-helix in alpha/beta classFrequency of alpha-helixKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKK00.250.50.7511.251.51.75Frequency of alpha-helix in alpha/beta class Export to raster or vector imagePrint the chart


Amino Acid Polarity Hydrophobic Hydrophilic
19(38 %) 30 (62 %)

Amino Acid Charge+vely charged-vely chargedNeutral Amino acid
11(22 %)2(4 %)36 (74 %)

Amino Acid Surface exposureSurface exposedBurried
33(67 %)16 (33 %)

DisorderDisorder-promotingOrder-promotingDisorder-order neutral
25(54 %)21(42 %)3 (4 %)

FlexibilityHighly flexibilityLow flexibility
31(63 %)18 (37 %)


Charge
KQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKK
P+veN-veO No chargeN
Polarity
KQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKK
PHydrophobicNhydrophilic


Numerical values of physicochemical properties are based on AAindex database (Kawashima et al. 2008)