Amino Acid CompositionAmino AcidACDEFGHIKLMNPQRSTVWY01234567891011Amino Acid % Composition of Peptide Export to raster or vector imagePrint the chart

Hydrophobicity("JURD980101")HydrophobicityMRILYLLLSVLFVVLQGVAGQPYFSSPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA0-7.5-5-2.52.55Hydrophobicity Export to raster or vector imagePrint the chart

Preference for beta-strandsPreference for beta-strandsMRILYLLLSVLFVVLQGVAGQPYFSSPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA00.511.52Preference for beta-strands Export to raster or vector imagePrint the chart

Frequency of alpha-helix in alpha/beta classFrequency of alpha-helixMRILYLLLSVLFVVLQGVAGQPYFSSPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA00.250.50.7511.251.51.75Frequency of alpha-helix in alpha/beta class Export to raster or vector imagePrint the chart


Amino Acid Polarity Hydrophobic Hydrophilic
41(61 %) 26 (39 %)

Amino Acid Charge+vely charged-vely chargedNeutral Amino acid
9(13 %)0(0 %)58 (87 %)

Amino Acid Surface exposureSurface exposedBurried
29(43 %)38 (57 %)

DisorderDisorder-promotingOrder-promotingDisorder-order neutral
32(49 %)33(49 %)2 (2 %)

FlexibilityHighly flexibilityLow flexibility
23(34 %)44 (66 %)


Charge
MRILYLLLSVLFVVLQGVAGQPYFSSPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA
P+veN-veO No chargeN
Polarity
MRILYLLLSVLFVVLQGVAGQPYFSSPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA
PHydrophobicNhydrophilic



Numerical values of physicochemical properties are based on AAindex database (Kawashima et al. 2008)