Amino Acid CompositionAmino AcidACDEFGHIKLMNPQRSTVWY012345678910111213141516Amino Acid % Composition of Peptide Export to raster or vector imagePrint the chart

Hydrophobicity("JURD980101")HydrophobicityNSVALDPIDISIELNKAKSDLEESKEWIRRSNQK0-7.5-5-2.52.55Hydrophobicity Export to raster or vector imagePrint the chart

Preference for beta-strandsPreference for beta-strandsNSVALDPIDISIELNKAKSDLEESKEWIRRSNQK00.511.52Preference for beta-strands Export to raster or vector imagePrint the chart

Frequency of alpha-helix in alpha/beta classFrequency of alpha-helixNSVALDPIDISIELNKAKSDLEESKEWIRRSNQK00.250.50.7511.251.51.75Frequency of alpha-helix in alpha/beta class Export to raster or vector imagePrint the chart


Amino Acid Polarity Hydrophobic Hydrophilic
12(35 %) 22 (65 %)

Amino Acid Charge+vely charged-vely chargedNeutral Amino acid
6(17 %)7(20 %)21 (63 %)

Amino Acid Surface exposureSurface exposedBurried
23(67 %)11 (33 %)

DisorderDisorder-promotingOrder-promotingDisorder-order neutral
19(61 %)12(35 %)3 (4 %)

FlexibilityHighly flexibilityLow flexibility
23(67 %)11 (33 %)


Charge
NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
P+veN-veO No chargeN
Polarity
NSVALDPIDISIELNKAKSDLEESKEWIRRSNQK
PHydrophobicNhydrophilic



Numerical values of physicochemical properties are based on AAindex database (Kawashima et al. 2008)