Amino Acid CompositionAmino AcidACDEFGHIKLMNPQRSTVWY024681012141618Amino Acid % Composition of Peptide Export to raster or vector imagePrint the chart

Hydrophobicity("JURD980101")HydrophobicityQVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPVSSCRGISFSQARSCCSRLGRCCHVGKGYS0-7.5-5-2.52.55Hydrophobicity Export to raster or vector imagePrint the chart

Preference for beta-strandsPreference for beta-strandsQVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPVSSCRGISFSQARSCCSRLGRCCHVGKGYS00.511.52Preference for beta-strands Export to raster or vector imagePrint the chart

Frequency of alpha-helix in alpha/beta classFrequency of alpha-helixQVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPVSSCRGISFSQARSCCSRLGRCCHVGKGYS00.250.50.7511.251.51.75Frequency of alpha-helix in alpha/beta class Export to raster or vector imagePrint the chart


Amino Acid Polarity Hydrophobic Hydrophilic
36(57 %) 27 (43 %)

Amino Acid Charge+vely charged-vely chargedNeutral Amino acid
10(15 %)0(0 %)53 (85 %)

Amino Acid Surface exposureSurface exposedBurried
35(55 %)28 (45 %)

DisorderDisorder-promotingOrder-promotingDisorder-order neutral
39(63 %)22(34 %)2 (3 %)

FlexibilityHighly flexibilityLow flexibility
29(46 %)34 (54 %)


Charge
QVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPVSSCRGISFSQARSCCSRLGRCCHVGKGYS
P+veN-veO No chargeN
Polarity
QVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPVSSCRGISFSQARSCCSRLGRCCHVGKGYS
PHydrophobicNhydrophilic


Numerical values of physicochemical properties are based on AAindex database (Kawashima et al. 2008)