Amino Acid CompositionAmino AcidACDEFGHIKLMNPQRSTVWY02.557.51012.51517.52022.52527.5Amino Acid % Composition of Peptide Export to raster or vector imagePrint the chart

Hydrophobicity("JURD980101")HydrophobicityVEELMKLLEELLKKLEELFKKLEEWFKKWFELSKKFT-6-4-20246Hydrophobicity Export to raster or vector imagePrint the chart

Preference for beta-strandsPreference for beta-strandsVEELMKLLEELLKKLEELFKKLEEWFKKWFELSKKFT00.511.52Preference for beta-strands Export to raster or vector imagePrint the chart

Frequency of alpha-helix in alpha/beta classFrequency of alpha-helixVEELMKLLEELLKKLEELFKKLEEWFKKWFELSKKFT00.250.50.7511.251.51.75Frequency of alpha-helix in alpha/beta class Export to raster or vector imagePrint the chart


Amino Acid Polarity Hydrophobic Hydrophilic
16(43 %) 21 (57 %)

Amino Acid Charge+vely charged-vely chargedNeutral Amino acid
9(24 %)9(24 %)19 (52 %)

Amino Acid Surface exposureSurface exposedBurried
20(54 %)17 (46 %)

DisorderDisorder-promotingOrder-promotingDisorder-order neutral
19(54 %)16(43 %)2 (3 %)

FlexibilityHighly flexibilityLow flexibility
19(51 %)18 (49 %)


Charge
VEELMKLLEELLKKLEELFKKLEEWFKKWFELSKKFT
P+veN-veO No chargeN
Polarity
VEELMKLLEELLKKLEELFKKLEEWFKKWFELSKKFT
PHydrophobicNhydrophilic



Numerical values of physicochemical properties are based on AAindex database (Kawashima et al. 2008)