Amino Acid CompositionAmino AcidAmino Acid % Composition of Peptide Export to raster or vector imagePrint the chart

Hydrophobicity("JURD980101")HydrophobicityYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSV-6-4-20246Hydrophobicity Export to raster or vector imagePrint the chart

Preference for beta-strandsPreference for beta-strandsYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSV00.511.52Preference for beta-strands Export to raster or vector imagePrint the chart

Frequency of alpha-helix in alpha/beta classFrequency of alpha-helixYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSV00.250.50.7511.251.51.75Frequency of alpha-helix in alpha/beta class Export to raster or vector imagePrint the chart


Amino Acid Polarity Hydrophobic Hydrophilic
(0 %) (100 %)

Amino Acid Charge+vely charged-vely chargedNeutral Amino acid
(0 %)(0 %)(100 %)

Amino Acid Surface exposureSurface exposedBurried
(0 %)(100 %)

DisorderDisorder-promotingOrder-promotingDisorder-order neutral
(0 %)(0 %)(100 %)

FlexibilityHighly flexibilityLow flexibility
(0 %)(100 %)


Charge
YENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSV
P+veN-veO No chargeN
Polarity
YENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSV
PHydrophobicNhydrophilic



Numerical values of physicochemical properties are based on AAindex database (Kawashima et al. 2008)