 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP0089 details | |
| AVPid | AVP0089 |
| Sequence | DAVYLHRIDLGPPISLERLDVGTNLQNAIAKLEDA |
| Nomenclature | T-253 |
| Length | 35 |
| Against virus | Measles virus (MV) |
| Virus Family | Paramyxoviridae |
| Source | MV fusion (F) protein |
| Uniprot | P69353 |
| Cell line | HEp2 |
| Inhibition/IC50 | >100 |
| Unit |
EC50 (μM) |
| Target | Fusion |
| Assay | Cytopathic effect |
| Properties | View |
| Structure | Jmol |
| Paper | Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion. |
| Authors | Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr. |
| Reference | Proc Natl Acad Sci U S A. 1996 |
| Accession | 8700906 |