 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP0091 details | |
|---|
| AVPid | AVP0091 |
| Sequence | VYLHRIDLGPPISLERLDVGTNLQNAIAKLEDAKE |
| Nomenclature | T-255 |
| Length | 35 |
| Against virus | Measles virus (MV) |
| Virus Family | Paramyxoviridae |
| Source | MV fusion (F) protein |
| Uniprot | P69353 |
| Cell line | HEp2 |
| Inhibition/IC50 | 85.3 |
| Unit |
EC50 (μM) |
| Target | Fusion |
| Assay | Cytopathic effect |
| Properties | View
|
| Structure | Jmol
|
| Paper | Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion.
|
| Authors | Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.
|
| Reference | Proc Natl Acad Sci U S A. 1996 |
| Accession | 8700906 |