 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP0422 details | |
|---|
| AVPid | AVP0422 |
| Sequence | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL |
| Nomenclature | - |
| Length | 35 |
| Against virus | Junin virus (JV) |
| Virus Family | Arenaviridae |
| Source | Cecropin A |
| Uniprot | P01508 |
| Cell line | Vero |
| Inhibition/IC50 | 3.4 |
| Unit |
EC50 (μM) |
| Target | Protein synthesis |
| Assay | Plaque assay |
| Properties | View |
| Structure | Jmol |
| Paper | Antiviral activity of antimicrobial cationic peptides against Junin virus and herpes simplex virus. |
| Authors | Albiol Matanic VC, Castilla V. |
| Reference | Int J Antimicrob Agents. 2004 |
| Accession | 15081088 |