 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP0460 details | |
|---|
| AVPid | AVP0460 |
| Sequence | YDHIQDHVNTMFSRLATSWCLLQNKERALWAEAA |
| Nomenclature | B477-510 |
| Length | 34 |
| Against virus | Bovine herpesvirus type 1 (BoHV 1) |
| Virus Family | Herpesviridae |
| Source | BoHV-1 HR1 Region |
| Uniprot | P12640 |
| Cell line | MDBK |
| Inhibition/IC50 | 5 |
| Unit |
EC50 (μM) |
| Target | Replication |
| Assay | Plaque assay |
| Properties | View |
| Structure | Jmol |
| Paper | A synthetic peptide from a heptad repeat region of herpesvirus glycoprotein B inhibits virus replication. |
| Authors | Okazaki K, Kida H. |
| Reference | J Gen Virol. 2004 |
| Accession | 15269351 |