 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP0550 details | |
|---|
| AVPid | AVP0550 |
| Sequence | NEVAKNLNESLIDLQELGKYEQYIKWPWYVW |
| Nomenclature | SARSWW-Va |
| Length | 31 |
| Against virus | SARS coronavirus (SARS-CoV) |
| Virus Family | Coronaviridae |
| Source | SARS-CoV spike protein |
| Uniprot | P11224 |
| Cell line | Vero E6 |
| Inhibition/IC50 | Nil |
| Unit |
- |
| Target | Fusion |
| Assay | Plaque assay |
| Properties | View |
| Structure | Jmol |
| Paper | Inhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein. |
| Authors | Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF. |
| Reference | Virus Res. 2006 |
| Accession | 16616792 |