AVPdb | A database of experimentally verified antiviral peptides

AVPdb A Database of Antiviral Peptides

AVP0581 details



AVPid	AVP0581
Sequence	RVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHW
Nomenclature	peptide 36-81
Length	46
Against virus	Epstein-Barr virus (EBV)
Virus Family	Herpesviridae
Source	EBV envelope protein (gp42)
Uniprot	P03205
Cell line	CHO-K1
Inhibition/IC₅₀	50
Unit	nM
Target	Fusion
Assay	Fusion assay
Properties	View
Structure	Jmol
Paper	Binding-site interactions between Epstein-Barr virus fusion proteins gp42 and gH/gL reveal a peptide that inhibits both epithelial and B-cell membrane fusion.
Authors	Kirschner AN, Lowrey AS, Longnecker R, Jardetzky TS.
Reference	J Virol. 2007
Accession	17581996