![CSIR India](images/csir-logo.png) |
AVPdb
A Database of Antiviral Peptides
|
![Bioinformatics center IMTECH](images/imtech-protein-center.png) |
AVP0816 details | |
AVPid | AVP0816 |
Sequence | CCFLNITNSHVSILQERPPLENRVLTGWGL |
Nomenclature | Pcr-400 |
Length | 30 |
Against virus | Human T-cell leukaemia virus 1 (HTLV 1) |
Virus Family | Retroviridae |
Source | HTLV-1 envelope glycoprotein (gp21) |
Uniprot | P14075 |
Cell line | 293T |
Inhibition/IC50 | 0.18±0.01 |
Unit |
μM |
Target | Virus entry |
Assay | Luciferase assay |
Properties | View |
Structure | Jmol |
Paper | Basic residues are critical to the activity of peptide inhibitors of human T cell leukemia virus type 1 entry. |
Authors | Lamb D, Mirsaliotis A, Kelly SM, Brighty DW. |
Reference | J Biol Chem. 2009 |
Accession | 19114713 |