 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP0816 details | |
| AVPid | AVP0816 |
| Sequence | CCFLNITNSHVSILQERPPLENRVLTGWGL |
| Nomenclature | Pcr-400 |
| Length | 30 |
| Against virus | Human T-cell leukaemia virus 1 (HTLV 1) |
| Virus Family | Retroviridae |
| Source | HTLV-1 envelope glycoprotein (gp21) |
| Uniprot | P14075 |
| Cell line | 293T |
| Inhibition/IC50 | 0.18±0.01 |
| Unit |
μM |
| Target | Virus entry |
| Assay | Luciferase assay |
| Properties | View |
| Structure | Jmol |
| Paper | Basic residues are critical to the activity of peptide inhibitors of human T cell leukemia virus type 1 entry. |
| Authors | Lamb D, Mirsaliotis A, Kelly SM, Brighty DW. |
| Reference | J Biol Chem. 2009 |
| Accession | 19114713 |