 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1061 details | |
| AVPid | AVP1061 |
| Sequence | MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVY |
| Nomenclature | HCVc1-35 |
| Length | 35 |
| Against virus | Hepatitis C virus (HCV) |
| Virus Family | Flaviviridae |
| Source | HCV core protein |
| Uniprot | P26663 |
| Cell line | Huh7 |
| Inhibition/IC50 | Nil |
| Unit |
- |
| Target | Replication |
| Assay | Luciferase assay |
| Properties | View |
| Structure | Jmol |
| Paper | Hepatitis C virus core-derived peptides inhibit genotype 1b viral genome replication via interaction with DDX3X. |
| Authors | Sun C, Pager CT, Luo G, Sarnow P, Cate JH. |
| Reference | PLoS One. 2010 |
| Accession | 20862261 |