![CSIR India](images/csir-logo.png) |
AVPdb
A Database of Antiviral Peptides
|
![Bioinformatics center IMTECH](images/imtech-protein-center.png) |
AVP1062 details | |
AVPid | AVP1062 |
Sequence | MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGV |
Nomenclature | HCVc1-34 |
Length | 34 |
Against virus | Hepatitis C virus (HCV) |
Virus Family | Flaviviridae |
Source | HCV core protein |
Uniprot | P26663 |
Cell line | Huh7 |
Inhibition/IC50 | Nil |
Unit |
- |
Target | Replication |
Assay | Luciferase assay |
Properties | View |
Structure | Jmol |
Paper | Hepatitis C virus core-derived peptides inhibit genotype 1b viral genome replication via interaction with DDX3X. |
Authors | Sun C, Pager CT, Luo G, Sarnow P, Cate JH. |
Reference | PLoS One. 2010 |
Accession | 20862261 |