|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1107 details | |
AVPid | AVP1107 |
Sequence | WCNWHNIDPWIQLMNRTQADLAEGPPVKEC |
Nomenclature | S25 |
Length | 30 |
Against virus | Classical swine fever virus (CSFV) |
Virus Family | Flaviviridae |
Source | CSFV envelope protein (E2) |
Uniprot | P21530 |
Cell line | PK15 |
Inhibition/IC50 | 42 |
Unit |
% |
Target | CSFV entering |
Assay | Plaque assay |
Properties | View |
Structure | Jmol |
Paper | Identification of host cell binding peptide from an overlapping peptide library for inhibition of classical swine fever virus infection. |
Authors | Li X, Wang L, Zhao D, Zhang G, Luo J, Deng R, Yang Y. |
Reference | Virus Genes. 2011 |
Accession | 21400206 |