 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1115 details | |
| AVPid | AVP1115 |
| Sequence | TLKNRYYEPRDSYFQQYMLKGEYQYWFDLD |
| Nomenclature | S5 |
| Length | 30 |
| Against virus | Classical swine fever virus (CSFV) |
| Virus Family | Flaviviridae |
| Source | CSFV envelope protein (E2) |
| Uniprot | P21530 |
| Cell line | PK15 |
| Inhibition/IC50 | 0 |
| Unit |
% |
| Target | CSFV entering |
| Assay | Plaque assay |
| Properties | View |
| Structure | Jmol |
| Paper | Identification of host cell binding peptide from an overlapping peptide library for inhibition of classical swine fever virus infection. |
| Authors | Li X, Wang L, Zhao D, Zhang G, Luo J, Deng R, Yang Y. |
| Reference | Virus Genes. 2011 |
| Accession | 21400206 |