![CSIR India](images/csir-logo.png) |
AVPdb
A Database of Antiviral Peptides
|
![Bioinformatics center IMTECH](images/imtech-protein-center.png) |
AVP1116 details | |
AVPid | AVP1116 |
Sequence | GLCPFDTSPVVKGKYNTTLLNGSAFYLVCP |
Nomenclature | S48 |
Length | 30 |
Against virus | Classical swine fever virus (CSFV) |
Virus Family | Flaviviridae |
Source | CSFV envelope protein (E2) |
Uniprot | P21530 |
Cell line | PK15 |
Inhibition/IC50 | 90 |
Unit |
% |
Target | CSFV entering |
Assay | Plaque assay |
Properties | View |
Structure | Jmol |
Paper | Identification of host cell binding peptide from an overlapping peptide library for inhibition of classical swine fever virus infection. |
Authors | Li X, Wang L, Zhao D, Zhang G, Luo J, Deng R, Yang Y. |
Reference | Virus Genes. 2011 |
Accession | 21400206 |