 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1133 details | |
| AVPid | AVP1133 |
| Sequence | VRDNMAKLRERLKQRQQLFDSQQGWFEGWFNRSPWFT |
| Nomenclature | EPK364 |
| Length | 37 |
| Against virus | Feline leukemia virus (FeLV) |
| Virus Family | Retroviridae |
| Source | FeLV transmembrane protein (TM) |
| Uniprot | P06752 |
| Cell line | FEA |
| Inhibition/IC50 | High |
| Unit |
- |
| Target | Fusion |
| Assay | ELISA |
| Properties | View |
| Structure | Jmol |
| Paper | In vitro inhibition of feline leukaemia virus infection by synthetic peptides derived from the transmembrane domain. |
| Authors | Boenzli E, Robert-Tissot C, Sabatino G, Cattori V, Meli ML, Gutte B, Rovero P, Flynn N, Hofmann-Lehmann R, Lutz H. |
| Reference | Antivir Ther. 2011 |
| Accession | 21900723 |