|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1134 details | |
AVPid | AVP1134 |
Sequence | VEENMKKLEERLKKREELFKKQEEWFKKWFERSKKFT |
Nomenclature | EPK397 |
Length | 37 |
Against virus | Feline leukemia virus (FeLV) |
Virus Family | Retroviridae |
Source | FeLV transmembrane protein (TM) |
Uniprot | P06752 |
Cell line | FEA |
Inhibition/IC50 | Medium |
Unit |
- |
Target | Fusion |
Assay | ELISA |
Properties | View |
Structure | Jmol |
Paper | In vitro inhibition of feline leukaemia virus infection by synthetic peptides derived from the transmembrane domain. |
Authors | Boenzli E, Robert-Tissot C, Sabatino G, Cattori V, Meli ML, Gutte B, Rovero P, Flynn N, Hofmann-Lehmann R, Lutz H. |
Reference | Antivir Ther. 2011 |
Accession | 21900723 |