![CSIR India](images/csir-logo.png) |
AVPdb
A Database of Antiviral Peptides
|
![Bioinformatics center IMTECH](images/imtech-protein-center.png) |
AVP1146 details | |
AVPid | AVP1146 |
Sequence | PPVCETGPLHPPSPPPLVRISLILVFVHLNKIRIRAREIYES |
Nomenclature | PA A11 |
Length | 42 |
Against virus | Influenza A virus (INFV A) |
Virus Family | Orthomyxoviridae |
Source | Conotoxin |
Uniprot | P01519 |
Cell line | 293T |
Inhibition/IC50 | Low |
Unit |
- |
Target | Nucleoprotein |
Assay | Luciferase assay |
Properties | View |
Structure | Jmol |
Paper | Inhibition of influenza virus replication by constrained peptides targeting nucleoprotein. |
Authors | Jiang H, Xu Y, Li L, Weng L, Wang Q, Zhang S, Jia B, Hu H, He Y, Jacob Y, Toyoda T. |
Reference | Antivir Chem Chemother. 2011 |
Accession | 22095520 |