 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1155 details | |
| AVPid | AVP1155 |
| Sequence | CICCCMCVLYAVLWWLSVLVSLCELLIRSEFELERSMNRRY |
| Nomenclature | PB1 4-1 |
| Length | 41 |
| Against virus | Influenza A virus (INFV A) |
| Virus Family | Orthomyxoviridae |
| Source | Conotoxin |
| Uniprot | P01519 |
| Cell line | 293T |
| Inhibition/IC50 | Low |
| Unit |
- |
| Target | Nucleoprotein |
| Assay | Luciferase assay |
| Properties | View |
| Structure | Jmol |
| Paper | Inhibition of influenza virus replication by constrained peptides targeting nucleoprotein. |
| Authors | Jiang H, Xu Y, Li L, Weng L, Wang Q, Zhang S, Jia B, Hu H, He Y, Jacob Y, Toyoda T. |
| Reference | Antivir Chem Chemother. 2011 |
| Accession | 22095520 |