|
AVPdb
A Database of Antiviral Peptides
|
|
AVP1222 details | |
AVPid | AVP1222 |
Sequence | RQIKINFQNRRMKNKKGELDELVYLLDGPGYDPIHS |
Nomenclature | Ant-CP5-46A-4D5E |
Length | 36 |
Against virus | Hepatitis C virus (HCV) |
Virus Family | Flaviviridae |
Source | Synthetic |
Cell line | E. coli |
Inhibition/IC50 | 23.6 |
Unit |
nM |
Target | Replication |
Assay | FRET assay |
Properties | View |
Structure | Jmol |
Paper | High affinity peptide inhibitors of the hepatitis C virus NS3-4A protease refractory to common resistant mutants. |
Authors | Kugler J, Schmelz S, Gentzsch J, Haid S, Pollmann E, van den Heuvel J, Franke R, Pietschmann T, Heinz DW, Collins J. |
Reference | J Biol Chem. 2012 |
Accession | 22965230 |