 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1222 details | |
| AVPid | AVP1222 |
| Sequence | RQIKINFQNRRMKNKKGELDELVYLLDGPGYDPIHS |
| Nomenclature | Ant-CP5-46A-4D5E |
| Length | 36 |
| Against virus | Hepatitis C virus (HCV) |
| Virus Family | Flaviviridae |
| Source | Synthetic |
| Cell line | E. coli |
| Inhibition/IC50 | 23.6 |
| Unit |
nM |
| Target | Replication |
| Assay | FRET assay |
| Properties | View |
| Structure | Jmol |
| Paper | High affinity peptide inhibitors of the hepatitis C virus NS3-4A protease refractory to common resistant mutants. |
| Authors | Kugler J, Schmelz S, Gentzsch J, Haid S, Pollmann E, van den Heuvel J, Franke R, Pietschmann T, Heinz DW, Collins J. |
| Reference | J Biol Chem. 2012 |
| Accession | 22965230 |