![CSIR India](images/csir-logo.png) |
AVPdb
A Database of Antiviral Peptides
|
![Bioinformatics center IMTECH](images/imtech-protein-center.png) |
AVP1235 details | |
AVPid | AVP1235 |
Sequence | MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY |
Nomenclature | DN59 |
Length | 33 |
Against virus | Dengue 2 virus (DENV 2) |
Virus Family | Flaviviridae |
Source | DENV envelope glycoprotein (gpE) |
Uniprot | P29984 |
Cell line | LLC-MK2 |
Inhibition/IC50 | 2to5 |
Unit |
μM |
Target | Virucidal |
Assay | Focus reduction assay |
Properties | View |
Structure | Jmol |
Paper | Release of dengue virus genome induced by a peptide inhibitor. |
Authors | Lok SM, Costin JM, Hrobowski YM, Hoffmann AR, Rowe DK, Kukkaro P, Holdaway H, Chipman P, Fontaine KA, Holbrook MR, Garry RF, Kostyuchenko V, Wimley WC, Isern S, Rossmann MG, Michael SF. |
Reference | PLoS One. 2012 |
Accession | 23226444 |