 |
AVPdb
A Database of Antiviral Peptides
|
 |
AVP1265 details | |
| AVPid | AVP1265 |
| Sequence | SVALDPIDISIELNKAKSDLEESKEWIRRSNQKL |
| Nomenclature | T-198 |
| Length | 34 |
| Against virus | Human parainfluenza virus type 3 (HPIV 3) |
| Virus Family | Paramyxoviridae |
| Source | HPIV3 fusion (F) protein |
| Uniprot | P06828 |
| Cell line | Vero |
| Inhibition/IC50 | High |
| Unit |
- |
| Target | Fusion |
| Assay | Immunoprecipitation |
| Properties | View |
| Structure | Jmol |
| Paper | Methods for the inhibition of respiratory syncytial virus transmission |
| Authors | Dani Paul Bolognesi, Thomas James Matthews, Carl T. Wild, Shawn O'Lin Barney,Dennis Michael Lambert, Stephen Robert Petteway |
| Reference | Trimeris, Inc., Durham NC |
| Accession | US6440656 |